KEGG   Pseudomonas savastanoi pv. phaseolicola 1448A: PSPPH_1361Help
Entry
PSPPH_1361        CDS       T00266                                 

Gene name
thrC
Definition
(GenBank) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
psp  Pseudomonas savastanoi pv. phaseolicola 1448A
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:psp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PSPPH_1361 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSPPH_1361 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PSPPH_1361 (thrC)
Enzymes [BR:psp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PSPPH_1361 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1577048..1578499
Genome map
AA seq 483 aa AA seqDB search
MKLKAFSSNQRFDPMRYISTRGQAPALNFEDVLLTGLASDGGLYVPENLPRFTQEEIASW
AGLPYHELAFRVMRPFVAGSIPDADFKKILEETYGVFAHSAVAPLRQLNGNEWVLELFHG
PTLAFKDFALQLLGRLLDYVLAKRGERVVIIGATSGDTGSAAIEGCRRCDNVDIFILHPN
NRVSDVQRRQMTTIFGDNIHNIAVEGNFDDCQEMVKASFADQGFLKGTRLVAVNSINWAR
IMAQIVYYFHASLQLGGPARSVSFSVPTGNFGDIFAGYLARNMGLPVNQLIVATNRNDIL
HRFMSGNQYVKETLHATLSPSMDIMVSSNFERLLFDMHGRNGSAIAELMSTFRQGGGFSV
EEERWTETRKLFDSLAVSDEDTCTTIAEVFASTGELLDPHTAIGVKAARECRRSLDTPMV
ILGTAHPVKFPEAVEKAGVGKALELPAHLSDLFERDERCTVLPNDLKAIQAFVSQHGNRG
KPL
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
ttgaagcttaaggctttcagctcaaaccaaaggtttgatcccatgcgctatatcagtact
cgcggccaggcgccggccctgaacttcgaagacgtgctgttgactggtctggccagcgac
ggcggtctgtatgtgccggaaaacctgccacgcttcactcaggaagagatcgcctcctgg
gccggtctgccgtatcacgaactggcctttcgggtgatgcgcccctttgtggctggcagc
atcccggatgccgatttcaaaaaaattcttgaagagacctacggtgtcttcgcccacagt
gcagtggcaccgttgcgtcagttgaatggcaacgagtgggtacttgagctgttccacggt
cctaccctggcgttcaaggactttgcgctgcaattgctcggccgcctgctggactacgtg
ctggccaagcgtggcgagcgtgtggtgatcatcggcgctacctcgggtgacaccggctct
gcagccatcgaaggctgccgtcgctgtgacaacgtcgacatcttcattctgcacccgaac
aatcgggtatcggatgtccagcgccggcagatgaccaccatctttggcgacaacatccac
aacattgcagtagaaggcaacttcgacgactgccaggaaatggtcaaggccagcttcgcc
gatcagggcttcctcaagggcacgcgtctggtcgccgtcaactcgatcaactgggcgcga
atcatggcccagatcgtctactacttccatgcatcgctgcagttgggcggtcccgcgcgc
tcggtatcgttctcggttccgaccggtaacttcggcgatatctttgccggttacctggca
cgcaacatggggctgccggtcaatcaactgatcgtcgccaccaaccgcaacgacattctg
caccgtttcatgagcggcaatcagtacgtcaaggaaaccctgcacgctacgttgtcgcct
tccatggacatcatggtgtcgtcgaacttcgaacgcctgttgttcgatatgcacggtcgc
aacggttctgccattgccgagttgatgagcacgttcaggcagggcggcggtttcagtgtc
gaagaagagcgctggaccgaaacccgcaaactgttcgattcgctggcagtcagcgacgag
gacacctgtacgaccattgctgaagtgtttgccagcaccggcgaactgcttgatccgcat
accgctatcggggtgaaggctgctcgcgaatgccgtcgcagcctggacacgccgatggtg
attctgggtacggcgcatccggtcaagtttccggaggcagtggagaaggccggtgtagga
aaagcgcttgagctacctgcacatttgtctgatttgttcgagcgtgacgagcgctgcact
gtgctgccaaatgacctgaaagccatacaggcatttgtcagccagcatggcaatcgcggc
aaaccactctaa

DBGET integrated database retrieval system