KEGG   Pseudomonas syringae pv. phaseolicola 1448A: PSPPH_1509Help
Entry
PSPPH_1509        CDS       T00266                                 

Gene name
asnB
Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
psp  Pseudomonas syringae pv. phaseolicola 1448A
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:psp00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1750343..1752115)
Genome map
AA seq 590 aa AA seqDB search
MCGLAGELRFDHQPADLAAVERITHQLAPRGPDAWGFHSQGPVALGHRRLKIMDLSDGSA
QPMIDSHLGLSMAFNGAIYNFPELRAELESLGYQFHSGGDTEVLLKGYHAWGADMLPKLN
GMFAFAIWERDSKQLFIARDRLGVKPLYLSKTDKRLRFASSLPALLKGGDISGMLDPVAL
NHYLNFHAVVPAPRTLLAGVEKLPPASWMRIDASGKVEQKVWWTLPYGPHEDEKNLTLED
WRDRVLDSTREAVAIRQRAAVDVGVLLSGGVDSSMLVGLLREVGVEDLSTFSIGFQDAGG
ERGDEFQYSDLIAKHYGTRHHQLRIQESEIIEQLPAAFRAMSEPMVSHDCIAFYLLSREV
SKHCKVVQSGQGADELFAGYHWYPQVDGASDPVAAYRDAFVDRSYAEYAETVQPKWRTAN
DAAGDFVRDHFAQPGASAAVDKALRLDSTVMLVDDPVKRVDNMTMAWGLEARTPFLDYRL
VELSARIPGKFKLPDDGKQVLKEAARLVIPSEVIDRKKGYFPVPGLKHLQGDTLNWVREL
LTDSSQDRGLFNPAMVDKLLTNPEGQLTPLRGSKLWQLAALNLWLSEQGL
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggattagcaggtgaacttcgttttgaccatcaaccagcggacctggccgctgtt
gagcgcattacccatcagctggcgcctcgcggcccggatgcgtgggggtttcacagccag
gggccggttgcccttggtcatcgccgtctgaaaatcatggacctgtcggatggctcggcg
cagccgatgatcgacagtcacctgggcctgtccatggccttcaacggtgcgatttataac
ttcccggaattacgtgccgagttggaaagccttggctatcagtttcattccggtggcgac
accgaggtgttgctcaagggctatcacgcctggggcgcagacatgctgcccaagctcaat
ggcatgttcgccttcgccatctgggagcgtgacagcaagcagctgttcatcgcccgtgac
cgcctcggcgtaaagccgttgtacctgtcaaaaaccgacaagcgcctgcgcttcgcgtct
tcgctgccagccctgctcaagggtggtgatatcagcggaatgcttgatccggtggcgctc
aaccattacctcaacttccacgctgtggtgcctgccccgcgcacgctgctggcgggcgtc
gagaagttgccgccagccagctggatgcgcatcgacgccagcggcaaggtcgagcagaaa
gtctggtggaccctgccttacggtcctcatgaagacgagaaaaacctcacgctcgaagac
tggcgcgaccgcgtattggacagcacccgtgaagcagtggcgattcgtcagcgtgccgcg
gtagacgtcggcgtgctgctttccggcggtgtcgactccagcatgctggtcggcctgttg
cgtgaagtgggggtcgaagacctgtcgaccttctctatcggctttcaggatgccggtggc
gagcgtggagatgaatttcagtattccgacctgatcgccaagcattacggcacacgccac
caccagttgcgtattcaggaaagcgagatcatcgaacagctgcctgcggcgttccgcgcc
atgagcgagccgatggtcagccacgactgtatcgccttctacctgctgtcgcgtgaagtg
tccaagcattgcaaggtggtacagagcggccagggcgctgacgagctgtttgccggttac
cactggtacccacaagtagacggcgcgagcgacccggttgcggcctaccgcgatgcgttt
gtcgaccgcagctatgcggaatatgccgagacggtgcagccgaagtggcgcacagccaac
gacgcagccggtgatttcgttcgcgatcatttcgcccagcccggtgccagcgcggcggtc
gacaaggcgttgcgcctggacagtacggtgatgctggtcgatgacccggtcaaacgagtc
gacaacatgaccatggcctggggcctggaagcgcgtacaccgttccttgactaccggctg
gttgagctgtctgcgcgtattccgggcaagttcaaattgcctgatgacggcaagcaagtg
ttgaaagaagcggcgcgtctggtcattccttcggaagtgatcgaccgcaagaagggctac
ttcccggttcccggcctcaagcacttgcagggcgacacccttaactgggtgcgtgaactg
ttgaccgactccagtcaggaccgcggcctgttcaatccggccatggtcgataagttgctg
accaacccagagggccagctcacgccattgcgcggctccaagctgtggcaactggcagcg
ctgaacctgtggctcagcgaacaaggactgtga

DBGET integrated database retrieval system