KEGG   Pseudomonas savastanoi pv. phaseolicola 1448A: PSPPH_1834Help
Entry
PSPPH_1834        CDS       T00266                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase family protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
psp  Pseudomonas savastanoi pv. phaseolicola 1448A
Pathway
psp00071  Fatty acid degradation
psp00280  Valine, leucine and isoleucine degradation
psp00281  Geraniol degradation
psp00310  Lysine degradation
psp00360  Phenylalanine metabolism
psp00362  Benzoate degradation
psp00380  Tryptophan metabolism
psp00410  beta-Alanine metabolism
psp00627  Aminobenzoate degradation
psp00640  Propanoate metabolism
psp00650  Butanoate metabolism
psp00903  Limonene and pinene degradation
psp00930  Caprolactam degradation
psp01100  Metabolic pathways
psp01110  Biosynthesis of secondary metabolites
psp01120  Microbial metabolism in diverse environments
psp01130  Biosynthesis of antibiotics
psp01212  Fatty acid metabolism
Module
psp_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:psp00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PSPPH_1834
   00650 Butanoate metabolism
    PSPPH_1834
  Lipid metabolism
   00071 Fatty acid degradation
    PSPPH_1834
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSPPH_1834
   00310 Lysine degradation
    PSPPH_1834
   00360 Phenylalanine metabolism
    PSPPH_1834
   00380 Tryptophan metabolism
    PSPPH_1834
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PSPPH_1834
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PSPPH_1834
   00281 Geraniol degradation
    PSPPH_1834
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSPPH_1834
   00627 Aminobenzoate degradation
    PSPPH_1834
   00930 Caprolactam degradation
    PSPPH_1834
Enzymes [BR:psp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PSPPH_1834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AAZ35488
UniProt: Q48KK9
Position
complement(2134362..2135051)
Genome map
AA seq 229 aa AA seqDB search
MSDLVSYHLDDGVATLTLNNGKVNAISPDVIIAFNAALDQAEQDRAIVIVTGQPGILSGG
YDLKVMTSSAEAAINLVAQGSTLARRMLSHPFPIIVACPGHAVAKGAFLLLSADYRIGVA
GPFSIGLNEVQIGMPMHHAGIELARDRLRKSAFNRSVINAEMFDPEGAMAAGFLDKVVSV
DELQNTALSVAAQLKKINMSAHKKTKLKVRKALLDTLDAAIEQDRQHML
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatctggtctcgtaccatctggacgacggtgtcgccacgctgaccctgaacaac
ggcaaggtcaatgccatttccccggacgtaatcatcgcgttcaatgctgcgctggatcag
gccgaacaggaccgggcaatcgtgatcgtcactggacagcccggcattctctcgggcggc
tacgacctcaaggtgatgacctcgagcgccgaagcggcgatcaatctggttgctcagggc
tccaccctggcgcgcagaatgctgtcacaccccttcccgatcattgtcgcctgccccggt
cacgcggttgccaagggtgcctttttgctgctgtccgccgattatcgaatcggtgtcgca
gggccattcagtatcggattgaacgaagtacagatcggcatgcccatgcaccacgccggc
atcgaactggcgcgtgaccggttgcgtaaatcagccttcaatcgctcagtgatcaacgcc
gaaatgttcgaccctgaaggcgcgatggccgccggcttcctggacaaggtggtcagcgtc
gatgaactgcaaaacaccgcattgtcggtcgctgcacagttgaagaagatcaacatgagc
gcgcacaagaagaccaaactcaaggtcagaaaagccttgctcgatacactggatgcagct
atcgagcaggatcggcaacacatgctgtga

DBGET integrated database retrieval system