KEGG   Pseudomonas syringae pv. phaseolicola 1448A: PSPPH_1839Help
Entry
PSPPH_1839        CDS       T00266                                 

Gene name
cycA
Definition
cytochrome c2
Orthology
K08738  
cytochrome c
Organism
psp  Pseudomonas syringae pv. phaseolicola 1448A
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:psp00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PSPPH_1839 (cycA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PSPPH_1839 (cycA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(2136758..2137126)
Genome map
AA seq 122 aa AA seqDB search
MRKTALFIVALALQPLAYGAGDAEAGKAVFTRLCSGCHKIGPSARNAFGPPLNGIIGRQA
GQQESYVYTDAMKNSGLVWTREELRTYIKDPGEVVPGTRMKLWWMGNDERMEDLLEYLDA
NK
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaactgccttattcatagtggcgctggcactgcaaccgctggcttacggcgca
ggtgatgcagaggccggaaaagcagtctttacccgcctctgctccggctgtcacaagatc
ggcccttctgcacgcaacgcatttggtccgcccctcaacggcatcattggccgtcaggca
gggcaacaggaaagctacgtttataccgatgcaatgaaaaactcgggactggtctggacg
cgtgaagagttgcgcacgtatatcaaagacccaggcgaagtcgtgcctggcacgcggatg
aaactgtggtggatgggcaacgatgagcgaatggaagacctgctcgaatacctggacgca
aacaaataa

DBGET integrated database retrieval system