KEGG   Pseudomonas savastanoi pv. phaseolicola 1448A: PSPPH_1977Help
Entry
PSPPH_1977        CDS       T00266                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
psp  Pseudomonas savastanoi pv. phaseolicola 1448A
Pathway
psp00020  Citrate cycle (TCA cycle)
psp00190  Oxidative phosphorylation
psp00650  Butanoate metabolism
psp01100  Metabolic pathways
psp01110  Biosynthesis of secondary metabolites
psp01120  Microbial metabolism in diverse environments
psp01130  Biosynthesis of antibiotics
psp01200  Carbon metabolism
Module
psp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
psp_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:psp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSPPH_1977 (sdhD)
   00650 Butanoate metabolism
    PSPPH_1977 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    PSPPH_1977 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: AAZ34396
UniProt: Q48K74
Position
2322329..2322697
Genome map
AA seq 122 aa AA seqDB search
MVTNVTNLSRSGLYDWMAQRVSAVVLAAYFIFLIGYMVFHPGLSYAQWHDLFAHNGMRIF
SLLALVALGAHAWVGMWTIATDYLTPMALGKSATAVRFLFQAVCGVLMFAYFVWGVQILW
GI
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaacgtcaccaacctttcgcgttcgggcctctatgactggatggctcagcgt
gtttctgcggtcgtgctcgcggcttatttcatattcctgatcggatacatggtctttcat
ccgggtctgagttacgcccaatggcatgatctgttcgcacacaacggaatgcgtatcttc
agtctgctggctctcgttgcccttggcgctcacgcctgggtcggcatgtggaccatcgcg
accgactacctgacgccgatggcgctgggcaagtctgccactgcagtacgttttctgttt
caggcagtatgcggcgttctgatgttcgcctacttcgtctggggcgtgcagattctttgg
ggtatctga

DBGET integrated database retrieval system