KEGG   Pseudomonas syringae pv. phaseolicola 1448A: PSPPH_1977Help
Entry
PSPPH_1977        CDS       T00266                                 

Gene name
sdhD
Definition
succinate dehydrogenase, hydrophobic membrane anchor protein (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
psp  Pseudomonas syringae pv. phaseolicola 1448A
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:psp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSPPH_1977 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSPPH_1977 (sdhD)
   00650 Butanoate metabolism
    PSPPH_1977 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    PSPPH_1977 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2322329..2322697
Genome map
AA seq 122 aa AA seqDB search
MVTNVTNLSRSGLYDWMAQRVSAVVLAAYFIFLIGYMVFHPGLSYAQWHDLFAHNGMRIF
SLLALVALGAHAWVGMWTIATDYLTPMALGKSATAVRFLFQAVCGVLMFAYFVWGVQILW
GI
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaacgtcaccaacctttcgcgttcgggcctctatgactggatggctcagcgt
gtttctgcggtcgtgctcgcggcttatttcatattcctgatcggatacatggtctttcat
ccgggtctgagttacgcccaatggcatgatctgttcgcacacaacggaatgcgtatcttc
agtctgctggctctcgttgcccttggcgctcacgcctgggtcggcatgtggaccatcgcg
accgactacctgacgccgatggcgctgggcaagtctgccactgcagtacgttttctgttt
caggcagtatgcggcgttctgatgttcgcctacttcgtctggggcgtgcagattctttgg
ggtatctga

DBGET integrated database retrieval system