KEGG   Pseudomonas savastanoi pv. phaseolicola 1448A: PSPPH_1981Help
Entry
PSPPH_1981        CDS       T00266                                 

Gene name
sucB
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
psp  Pseudomonas savastanoi pv. phaseolicola 1448A
Pathway
psp00020  Citrate cycle (TCA cycle)
psp00310  Lysine degradation
psp01100  Metabolic pathways
psp01110  Biosynthesis of secondary metabolites
psp01120  Microbial metabolism in diverse environments
psp01130  Biosynthesis of antibiotics
psp01200  Carbon metabolism
Module
psp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:psp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSPPH_1981 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    PSPPH_1981 (sucB)
Enzymes [BR:psp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PSPPH_1981 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AAZ34236
UniProt: Q48K70
Position
2328323..2329543
Genome map
AA seq 406 aa AA seqDB search
MAIEIKAPSFPESVADGTISKWYKKEGDAVKRDEMLVDIETDKVVLEVLAEADGVMGSIT
KEEGAIVLSNEVLGTLNDGATASAATAPAAAPASAPAAAPAAAGEEDPIAAPAARQLAEE
NGINLASVKGTGKDGRITKEDVVAAVEAKKSAPAAAPAAKPAAAAAPVVAAGDRTEKRVP
MTRVRATVAKRLVEAQSNMAMLTTFNEVDMTEVMALRSKYKDLFEKSHNGVRLGFMSFFV
KAATEALKRFPAVNASIDGSDIVYHGYADVGVAVSSDRGLVVPVLRNAEHMSLAEIEGGI
ATFGKKARDGKLSIDEMTGGTFTITNGGTFGSMMSTPIVNPPQAAILGMHNILQRPMAVN
GQVVIRPMMYLALSYDHRLIDGKEAVTFLVTIKNLLEDPARLLLDI
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgagatcaaagccccctctttcccggaatccgttgccgatggcaccatttcc
aagtggtacaaaaaagagggtgatgcggtaaaacgggacgagatgctggtcgatatcgag
actgacaaggttgttctggaagtattggccgaagctgacggcgtgatgggctcgatcacc
aaggaagagggcgctatcgtcctctccaacgaagtgcttggcactttgaatgatggtgcc
acggcatctgctgctacagcacctgctgctgcgcctgcctcggcacccgccgctgcaccg
gctgccgctggcgaagaagacccgattgctgcgcctgctgcgcgtcaactcgctgaagaa
aacggtatcaacctggccagcgtcaaaggcactggtaaagacggccgtatcaccaaggaa
gacgtggtcgctgccgttgaagcgaagaaatccgctccagccgctgctcctgctgccaaa
cctgctgccgctgccgcaccggttgtcgctgctggtgaccgcaccgagaagcgcgtgccg
atgactcgtgtacgtgcaaccgttgccaagcgtctggtcgaagcccagtcgaacatggcc
atgctgactacgttcaacgaagtcgacatgaccgaagtcatggcgctgcgttcgaagtac
aaggacctgttcgagaagtcgcacaacggcgtacgtctgggcttcatgtcgttcttcgtc
aaggctgctaccgaggcgctgaaacgcttcccggctgtcaacgcgtcgatcgacggctcc
gacatcgtctaccacggctacgccgacgtcggtgttgcagtgtccagcgaccgtggtctg
gttgtaccggttctgcgtaacgccgagcacatgagcctggctgaaattgaaggcggcatc
gccaccttcggcaagaaggcccgtgatggcaaactgtccatcgacgagatgaccggtggc
accttcacgatcactaatggtggtactttcggttcgatgatgtcgacgccgatcgtcaac
ccgccacaggctgcaattctgggcatgcacaacattcttcagcgcccgatggcagtcaac
ggtcaggtagtgattcgtccgatgatgtatctggcattgtcgtacgatcaccgtttgatt
gacggcaaggaagcggtaaccttcctcgtgaccatcaagaacctgctggaagatccggct
cgtctgttgctggatatctga

DBGET integrated database retrieval system