KEGG   Pseudomonas syringae pv. phaseolicola 1448A: PSPPH_1983Help
Entry
PSPPH_1983        CDS       T00266                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
psp  Pseudomonas syringae pv. phaseolicola 1448A
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:psp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSPPH_1983 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSPPH_1983 (sucC)
   00640 Propanoate metabolism
    PSPPH_1983 (sucC)
   00660 C5-Branched dibasic acid metabolism
    PSPPH_1983 (sucC)
Enzymes [BR:psp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PSPPH_1983 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2331359..2332525
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQGKQLFAEYGLPVSKGYAVDTPEAAAEACDKIGGTEWVVKAQVHAGGRGKAGGV
KLVRSKEDAAAFAQQWLGKRLVTYQTDANGQPVTKILVESCTHIAKELYLGAVVDRSSRR
IVFMASTEGGVDIEKIAHDTPEKILKATIDPLVGAQPFQGRDLAFQLGLEGKQVTQFAKI
FTGLAKLFQDHDLALLEVNPLVIKADGDLHCLDAKINIDANAMYRQPKLKGFHDPSQDDP
REAHAAKFELNYVALEGNIGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVTE
AFKIILSDTNVAAVLVNIFGGIVRCDMIAEGIIGAVKEVGVKIPVVVRLEGNNAELGAKV
LAESGLNIIAATSLTDAAQQVVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttcacgagtatcagggtaagcagctgttcgctgagtacggcctgccagtatcc
aagggttacgcggtagacaccccggaagcagcagcagaagcctgcgacaagatcggcgga
accgagtgggtcgtcaaagcccaggttcacgcaggtggtcgcggtaaagcgggcggcgta
aagctggttcgcagcaaggaagacgctgcagcgttcgctcaacagtggttgggcaagcgc
ctggtgacttaccagactgacgccaacggtcagccagtgaccaagatcctggtcgaatcg
tgcacccacatcgccaaagagctgtatctgggcgctgtggtcgatcgttccagccgtcgt
atcgtgttcatggcttccaccgaaggtggcgtggacatcgagaagatcgctcacgacacc
cctgaaaagattctcaaggccacgatcgacccactggtcggcgctcagccgttccagggc
cgcgatctggcattccagctgggtctggaaggcaagcaggtcactcagttcgccaagatc
ttcaccggtctggccaagctgttccaggaccatgacctggccctgctggaagtgaacccg
ctggtgatcaaggctgacggcgatctgcactgcctggacgccaagatcaacatcgacgcc
aacgccatgtaccgtcagccaaagctgaagggcttccatgatccttcgcaggacgatcct
cgcgaagctcacgccgccaagttcgaactgaactacgtagcgctggaaggcaacatcggc
tgcatggtcaacggtgctggcctggccatgggtaccatggacatcgtcaacctgcatggc
ggcaagcctgcaaacttccttgacgttggcggtggtgccaccaaggaacgcgttaccgaa
gcgttcaagatcatcctgtccgacaccaacgtcgccgcagtactggtcaacatcttcggc
ggcatcgttcgttgcgacatgattgccgaaggcatcatcggtgcagtgaaagaagtcggc
gtgaaaatcccggttgttgttcgccttgaaggtaacaacgctgaactgggcgctaaagta
ctggcagaaagcggtttgaacatcatcgctgcgaccagcctgaccgacgctgctcaacaa
gttgtcaaagccgcggagggcaagtaa

DBGET integrated database retrieval system