KEGG   Pseudomonas savastanoi pv. phaseolicola 1448A: PSPPH_1983Help
Entry
PSPPH_1983        CDS       T00266                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
psp  Pseudomonas savastanoi pv. phaseolicola 1448A
Pathway
psp00020  Citrate cycle (TCA cycle)
psp00640  Propanoate metabolism
psp00660  C5-Branched dibasic acid metabolism
psp01100  Metabolic pathways
psp01110  Biosynthesis of secondary metabolites
psp01120  Microbial metabolism in diverse environments
psp01130  Biosynthesis of antibiotics
psp01200  Carbon metabolism
Module
psp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:psp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSPPH_1983 (sucC)
   00640 Propanoate metabolism
    PSPPH_1983 (sucC)
   00660 C5-Branched dibasic acid metabolism
    PSPPH_1983 (sucC)
Enzymes [BR:psp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PSPPH_1983 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp OKR_DC_1_N
Motif
Other DBs
NCBI-ProteinID: AAZ36479
UniProt: Q48K68
Position
2331359..2332525
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQGKQLFAEYGLPVSKGYAVDTPEAAAEACDKIGGTEWVVKAQVHAGGRGKAGGV
KLVRSKEDAAAFAQQWLGKRLVTYQTDANGQPVTKILVESCTHIAKELYLGAVVDRSSRR
IVFMASTEGGVDIEKIAHDTPEKILKATIDPLVGAQPFQGRDLAFQLGLEGKQVTQFAKI
FTGLAKLFQDHDLALLEVNPLVIKADGDLHCLDAKINIDANAMYRQPKLKGFHDPSQDDP
REAHAAKFELNYVALEGNIGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVTE
AFKIILSDTNVAAVLVNIFGGIVRCDMIAEGIIGAVKEVGVKIPVVVRLEGNNAELGAKV
LAESGLNIIAATSLTDAAQQVVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttcacgagtatcagggtaagcagctgttcgctgagtacggcctgccagtatcc
aagggttacgcggtagacaccccggaagcagcagcagaagcctgcgacaagatcggcgga
accgagtgggtcgtcaaagcccaggttcacgcaggtggtcgcggtaaagcgggcggcgta
aagctggttcgcagcaaggaagacgctgcagcgttcgctcaacagtggttgggcaagcgc
ctggtgacttaccagactgacgccaacggtcagccagtgaccaagatcctggtcgaatcg
tgcacccacatcgccaaagagctgtatctgggcgctgtggtcgatcgttccagccgtcgt
atcgtgttcatggcttccaccgaaggtggcgtggacatcgagaagatcgctcacgacacc
cctgaaaagattctcaaggccacgatcgacccactggtcggcgctcagccgttccagggc
cgcgatctggcattccagctgggtctggaaggcaagcaggtcactcagttcgccaagatc
ttcaccggtctggccaagctgttccaggaccatgacctggccctgctggaagtgaacccg
ctggtgatcaaggctgacggcgatctgcactgcctggacgccaagatcaacatcgacgcc
aacgccatgtaccgtcagccaaagctgaagggcttccatgatccttcgcaggacgatcct
cgcgaagctcacgccgccaagttcgaactgaactacgtagcgctggaaggcaacatcggc
tgcatggtcaacggtgctggcctggccatgggtaccatggacatcgtcaacctgcatggc
ggcaagcctgcaaacttccttgacgttggcggtggtgccaccaaggaacgcgttaccgaa
gcgttcaagatcatcctgtccgacaccaacgtcgccgcagtactggtcaacatcttcggc
ggcatcgttcgttgcgacatgattgccgaaggcatcatcggtgcagtgaaagaagtcggc
gtgaaaatcccggttgttgttcgccttgaaggtaacaacgctgaactgggcgctaaagta
ctggcagaaagcggtttgaacatcatcgctgcgaccagcctgaccgacgctgctcaacaa
gttgtcaaagccgcggagggcaagtaa

DBGET integrated database retrieval system