KEGG   Pseudomonas syringae pv. phaseolicola 1448A: PSPPH_2039Help
Entry
PSPPH_2039        CDS       T00266                                 

Definition
acyl-CoA thioesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
psp  Pseudomonas syringae pv. phaseolicola 1448A
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:psp00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PSPPH_2039
Enzymes [BR:psp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PSPPH_2039
   3.1.2  Thioester hydrolases
    3.1.2.-  
     PSPPH_2039
Lipid biosynthesis proteins [BR:psp01004]
 Fatty acid synthase
  Component type
   PSPPH_2039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2392530..2393135
Genome map
AA seq 201 aa AA seqDB search
MRALFLSAGLGLLLLSQGALAGTVLIVGDSISAAFGLDTRVGWVSLLEQRLSKEGFDDKV
VNASISGDTSAGGQARLPALLAEHKPELVILELGGNDGLRGQQPAQLQQNLSSMIDSSRA
AGAKVLLLGMQIPPNYGPRYTNAFKEVYSNLAEQKKVPFVHFFLEGVGGVPELMQADGLH
PAAAAQGKLLENVWPSLKPLL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcgttgtttttaagtgctggcctggggttactgctgctgtcacagggcgcgttg
gcgggcacggtattgatcgttggggatagtatcagtgcggctttcggactggatacccgc
gtggggtgggtcagcctgctggagcagcgtctgagcaaggagggattcgacgacaaggtg
gtcaatgcgtcgatcagtggcgacaccagtgccgggggccaggcgcgtttgcctgcgctg
cttgcagagcataagccggaactggttattctcgaattgggtggcaacgacggactgcgt
ggccagcagcccgctcaattgcaacaaaacctttcatcgatgatcgacagctctcgggca
gccggtgcgaaagtgttgctgctgggcatgcagataccgcccaactacgggccgcgttac
accaacgcgttcaaagaggtttacagcaacctggccgagcagaaaaaagtcccgtttgtg
cacttctttctggaaggtgtgggcggagtgcccgaactgatgcaggctgatggtctgcat
ccggcggcggctgctcagggcaagttgctggaaaatgtctggccgagcctgaaaccgctg
ctttga

DBGET integrated database retrieval system