KEGG   Pseudomonas syringae pv. phaseolicola 1448A: PSPPH_2129Help
Entry
PSPPH_2129        CDS       T00266                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
psp  Pseudomonas syringae pv. phaseolicola 1448A
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:psp00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PSPPH_2129 (rbsK)
Enzymes [BR:psp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PSPPH_2129 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2486673..2487593
Genome map
AA seq 306 aa AA seqDB search
MQAKIVIVGSLNMDLVIRAQRLPRPGETLSGETFDTVPGGKGANQAVAAARLGGSVAMIG
CVGADAYGEQLRAALLAEHIDCQAVTVVEGVSTGIASIVVDASSQNAIVIVAGGNGRLTP
ALIERFDALLAGSGIVICQLEVPTETVFHTLTRARALGKTVILNPAPASEPLPANWYGLI
DYLIPNESEAQTLTGVTVDSSAAAEEAAAAMLAAGARNVIITLGERGTLFASAAGVEHIP
ARRVQAVDTTAAGDTFVGGFAAALAAGQSESQAIRFGQAAAAISVTRAGAQPSIPTFEEV
KEFDSL
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcaaaaatagtgatagtgggcagtctgaacatggatctggtcatccgcgcccag
cgtctgccgcgccccggcgagacgctgagcggggaaacgttcgacaccgtgcctggcggt
aaaggcgccaatcaggcagttgccgcagcgcgcctgggtggcagtgtggcgatgatcggc
tgtgtgggtgccgatgcctacggggaacaactgcgtgcagcattgctggctgagcatatc
gactgtcaggccgtgacggtcgttgaaggcgtatccaccgggatcgcttcgattgtggtc
gacgccagcagtcagaatgcaattgtcattgttgccggcggcaatggtcggctcactccg
gcattgatcgagcgtttcgacgcattgctggcgggttccgggatcgtcatttgccagctt
gaagtaccgactgaaacagttttccacaccctgacccgcgcccgcgcgctgggcaagacc
gtcattctcaatcctgccccggccagcgagcctttgccggcaaactggtatggcctgatc
gactatctgatccccaatgaaagcgaggcgcagaccctgaccggtgtgactgtcgactcc
tcggcggcggctgaagaagcggcagcggccatgctggcggccggggcgcgcaacgtaatc
attaccctgggtgaacgcggaaccctgttcgccagtgctgcgggcgtggaacatatccct
gcgcgtcgtgtacaggccgtggacaccaccgctgcaggtgatacctttgtcggtggtttt
gccgcagcactggcggcgggtcagagtgaatcgcaggccattcgcttcggtcaggccgcg
gcagccatatccgtgacccgcgcgggtgcccagccgtccatcccgacgttcgaggaagta
aaggaattcgattcactatga

DBGET integrated database retrieval system