KEGG   Pseudomonas savastanoi pv. phaseolicola 1448A: PSPPH_2209Help
Entry
PSPPH_2209        CDS       T00266                                 

Gene name
phbA2
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
psp  Pseudomonas savastanoi pv. phaseolicola 1448A
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:psp00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSPPH_2209 (phbA2)
   00630 Glyoxylate and dicarboxylate metabolism
    PSPPH_2209 (phbA2)
   00640 Propanoate metabolism
    PSPPH_2209 (phbA2)
   00650 Butanoate metabolism
    PSPPH_2209 (phbA2)
  Lipid metabolism
   00071 Fatty acid degradation
    PSPPH_2209 (phbA2)
   00072 Synthesis and degradation of ketone bodies
    PSPPH_2209 (phbA2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSPPH_2209 (phbA2)
   00310 Lysine degradation
    PSPPH_2209 (phbA2)
   00380 Tryptophan metabolism
    PSPPH_2209 (phbA2)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PSPPH_2209 (phbA2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSPPH_2209 (phbA2)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PSPPH_2209 (phbA2)
Enzymes [BR:psp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PSPPH_2209 (phbA2)
Exosome [BR:psp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSPPH_2209 (phbA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2565131..2566339
Genome map
AA seq 402 aa AA seqDB search
MSIERTPLRQDPVVIVSAARTPMGGFQGDLQSLSATELGSIAIRAAVERAGIESADVQHV
LFGCVLPAGLGQAPARQAALGAGLGNATLCSTVNKMCGSGMQTAIMAHDLLMADSTAVVV
AGGMESMSNAPYLLDRARNGYRMGHGKVLDHMFLDGLEDAYEPGRLMGTFAEDCAGSKGF
SCEAQDGFALASLARAQEAIADGHFDAEIVPVQVTVGKESRQIIHDEQPPKARPDKIPTL
KPAFREGGTVTAANSSSISDGAAALLLMRQSEAQRRGLRPLAVFYAHAAFADQPGLFPTA
PIGAIQRLLSKTGWALDDVDLFEINEAFAVVPLVAMSELGLAHEKVNVNGGACALGHPIG
ASGARIIVTLLAALQRRQLKRGVAAICIGGGEATAVAIEIID
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcgaaaggacaccccttcgtcaagaccctgtggtcattgtcagcgctgcgcgc
acgcctatgggcggttttcagggtgatctgcagagcctgagtgccacagaactgggttcg
atcgccatccgcgcggccgttgagcgggcaggcattgaaagtgcagacgtgcagcatgtg
ctgtttggttgtgtgctgccggcgggcctcggtcaagcgcccgctcgacaagctgcgctc
ggggccgggctaggcaatgcgacgctgtgcagcacggtcaacaagatgtgcggttccggt
atgcagaccgcaatcatggcccatgacctgttgatggcagacagcacggcggtggtagtg
gctggtgggatggagagcatgtccaatgcaccttacctactggatcgcgctcgcaatggc
taccgcatggggcacggcaaggtgctggaccatatgtttctggatggccttgaggatgcc
tatgagccgggtcggctgatgggtaccttcgccgaagactgcgccgggtcgaaggggttc
agttgcgaggcgcaggatgggttcgctctggcgtcactggcccgcgcgcaggaggccatc
gccgacggtcatttcgacgcagaaatcgtgccggtgcaggtcaccgtgggtaaagagtcc
aggcagatcattcacgatgaacaaccgcccaaggcgcgtccggacaagatcccgacgctc
aagcccgcctttcgcgagggcggcacggttacggcagccaactccagctcaatctccgat
ggcgccgcagcactgctgttgatgcgtcagtccgaggcgcagcggcgagggttgcggccc
ttggcggtgttttacgcacatgcggcatttgccgaccagccgggcctgtttccaaccgca
ccgataggcgccattcagcgtctgctgagcaagacaggctgggcgctggatgacgtcgat
ctgttcgagatcaacgaagcgtttgcagtcgtgccgctggtagcgatgagtgaactgggc
cttgcgcacgagaaggtcaatgtcaacggtggggcgtgcgcgctgggtcatccgataggc
gcttcgggcgcgcggatcattgtgacgctgttggcggctttgcagcgcaggcagctcaag
cgcggggtggcggcgatttgcatcggtggcggagaggccaccgccgtcgccattgaaatc
atcgattag

DBGET integrated database retrieval system