KEGG   Pseudomonas syringae pv. phaseolicola 1448A: PSPPH_2226Help
Entry
PSPPH_2226        CDS       T00266                                 

Gene name
bchI
Definition
magnesium chelatase ATPase subunit I
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
psp  Pseudomonas syringae pv. phaseolicola 1448A
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:psp00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2587274..2588302
Genome map
AA seq 342 aa AA seqDB search
MTLPDPNITETAHFPLAAVVGADDLKLALCLTAIDPRIGGVLIEGPRGMAKSTLARGLAD
VLASGQFVTLPLGATEERLVGTLDLDAALAEGRAQFSPGVLAKADGGVLYVDEVNLLADH
LVDLLLDVAASGVNMVERDGISHRHAARFVLIGTMNPEEGELRPQLLDRFGLNVALSGQT
QPAERSQIIRRRLDFDSDPVMFCQQWQAQQDALKLRCEQARQLLAGIELDDHSLAMITER
CFAAGVDGMRADLVWLRAARAHAAWRGAGRIEEQDIEAVAEFALRHRRREPAPPPQNPEA
PPPGSSSRQADPESGQGNWGELPAQAVTTGARREVPSWPKKP
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaccttgcctgacccgaacatcaccgaaactgcacattttccgctggccgccgtggtc
ggtgccgatgacctgaagctggcgttgtgcctgaccgccattgacccgcgcatcggcggc
gtattgatcgaagggcctcggggcatggccaagtcgacgctggcgcggggattggccgat
gtgctggccagtggtcagttcgtcaccttgccgctgggtgctactgaagagcgtctggtc
ggcacgctggatctggacgccgcgctggccgagggtcgtgcacaattttccccgggtgta
ctcgccaaagccgacggcggtgtgctgtacgtcgatgaggtcaatctgctcgccgaccat
ctggtcgacctgttgctggacgttgctgccagcggcgtcaatatggtcgagcgggatggt
atttcccatcgccatgcagcgcgcttcgtactgatcggcaccatgaacccggaagaaggc
gaattgcgcccgcagttgctggatcgctttggcttgaacgtcgcattgagtggccagacc
cagcctgccgagcgcagtcagatcatccgtcgccgtctggatttcgacagcgatccggta
atgttttgccagcaatggcaagcgcagcaggacgccttgaagcttcgttgtgagcaggcg
cgtcagctgttggcaggtatcgagctggatgaccattcattggcaatgatcaccgagcga
tgctttgctgcaggtgtcgacggtatgcgcgccgatctggtctggctgcgcgccgcgcgc
gcccatgctgcatggcgtggtgccggtcgaattgaagaacaggacatcgaagcggtcgcc
gagtttgccttgcgtcatcggcggcgcgagccggccccgccaccacaaaacccggaagcg
ccgccgcccggatcgtccagcaggcaggccgaccctgaaagcgggcagggcaactggggc
gagctgcccgcccaggccgtcactaccggcgcacgccgcgaagtgccgagctggccaaaa
aagccttag

DBGET integrated database retrieval system