KEGG   Pseudomonas syringae pv. phaseolicola 1448A: PSPPH_2260Help
Entry
PSPPH_2260        CDS       T00266                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
psp  Pseudomonas syringae pv. phaseolicola 1448A
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:psp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PSPPH_2260 (galU)
   00052 Galactose metabolism
    PSPPH_2260 (galU)
   00500 Starch and sucrose metabolism
    PSPPH_2260 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    PSPPH_2260 (galU)
Enzymes [BR:psp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PSPPH_2260 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2621468..2622307
Genome map
AA seq 279 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALAAGLTEISIVTGRGKR
ALEDHFDISYELEHQIKGTDKEKYLVGIRKLIDECSFSYTRQTEMKGLGHAILSGRPLIG
NEAFAVVLADDLCVNPDGDGVLAQMVKLHKHYGCSIIAIQEVDPQETNKYGVIAGEEIKP
GLFRVTNMVEKPKPEDAPSNLAIIGRYILTPDIFEKIEQTEPGKGGEIQITDALMKQAAE
GNVLAYKFKGERFDCGGAEGYIQATNFCFEHFYKTGKAH
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagaaatgcttgttcccagcagccggttacggcactcgcttcctgccagcgact
aaggccatgcccaaggaaatgctgccggtggtcaacaagccactgatccaatacggtgtt
gaggaagccctcgcggcaggcctgaccgaaatttccatcgtgaccggtcgtggcaagcgt
gctcttgaagatcactttgatatcagctacgagcttgagcatcagatcaagggcacggac
aaggaaaagtacctggttggtattcgcaaactgatcgacgagtgcagcttttcctacact
cgccagactgaaatgaaaggtctgggtcatgccattctcagcggtcgtccgctgattggt
aatgaagcattcgccgtggttctggcggatgacttgtgcgtaaatcctgatggtgatggc
gtgctggcgcagatggtcaaactgcacaagcattatggctgctcgatcattgccattcag
gaagtcgatccgcaggaaaccaacaagtatggcgtgatcgccggtgaagaaatcaagccg
ggcctgtttcgcgtgaccaacatggttgaaaaaccgaagcctgaagatgcgccttccaac
ctggcgatcatcggccgctacatcctgactccggatattttcgagaagatcgaacagact
gagccaggcaagggtggggagatccagatcaccgacgccctgatgaagcaggctgcagaa
ggcaacgtactggcctacaagttcaagggcgagcgctttgactgcggtggcgctgaaggc
tacatccaggctaccaacttctgcttcgaacacttttacaaaaccggcaaagcgcattga

DBGET integrated database retrieval system