KEGG   Pseudomonas syringae pv. phaseolicola 1448A: PSPPH_2504Help
Entry
PSPPH_2504        CDS       T00266                                 

Gene name
galM
Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
psp  Pseudomonas syringae pv. phaseolicola 1448A
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSPPH_2504 (galM)
   00052 Galactose metabolism
    PSPPH_2504 (galM)
Enzymes [BR:psp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     PSPPH_2504 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2890361..2891509)
Genome map
AA seq 382 aa AA seqDB search
MKTHALLSTLGLSLMISTLTAQAAALSSEHSTFGQLPDGTAVEKFTLRNSHGVQASIITY
GATLQSLLVPDKAGKVEDIVLGFDDVQGYQNNGTVYFGATIGRFGNRLAGGKFSLDGKTY
QVPLNDKTNALHGGTQGFDKRLWKAEETKTGDSVGVKLTYVSPDGEMGFPGTLKTEVTYS
LNEKNELKIDYRATTDKPTVLNLTNHSYFNLAGAGSGDVLKQVATLHASHYTPVNDKLIP
TGELPAVAGTPMDFLKPTAFGKHIKDDHQQLKYAEPKQGGFDFNWVLDTKGDVKKLAAEV
SDPQSGRRLQLFTTEPGVQLYTGNFLDGSIHGKAGKVYPHWGAFTLETQHCPDAPNQPKF
PSTRLDPGKAYTQTTVFKFLNN
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacacatgctctcctcagcacccttggactgtccttgatgatcagcaccttgact
gcacaggccgcggcactctccagcgagcacagcactttcggccaactgcccgacggcact
gccgtcgagaaattcaccctgcgcaacagtcacggcgtgcaggccagcatcatcacctac
ggcgcgacgctgcaatcgctgctggtgcctgacaaggccggaaaggtcgaggacatcgtc
ctgggcttcgacgatgttcagggctaccagaacaacggcacggtttatttcggcgcgacc
atcggccgattcggcaaccgcctggcaggcggcaagttcagcctggatggcaagacctac
caggtcccactcaacgacaagaccaatgccctgcacggcggcactcagggttttgacaaa
cgactctggaaggcagaagaaaccaagaccggtgattcggtcggcgtgaagctgacctac
gtgtcgccggatggcgagatgggctttccgggcacattgaaaactgaagtcacttacagc
ctgaatgagaaaaacgagctgaagattgactaccgcgccaccactgacaagccgacagtg
ctgaacctgaccaaccatagctatttcaacctggcgggtgcaggcagcggtgatgtactc
aaacaggtcgccaccctgcacgcttcgcactacacaccggtcaacgacaagctgatcccg
accggcgaactgcctgccgtcgcgggcacgccgatggacttcctcaagcccaccgcgttc
ggcaagcacataaaggatgatcaccagcagttgaaatatgccgaacccaaacaaggcggt
tttgatttcaactgggtactcgacactaagggtgatgtgaagaaactggccgccgaggtc
agcgacccgcaatcaggccgcaggctgcagctgttcaccacagagccaggcgtacagctg
tataccggcaacttcctggatggcagcattcatggcaaggcgggcaaggtctacccgcac
tggggcgcctttaccctggagacccagcactgtcctgatgcgcccaatcagccgaaattt
cccagcacacgactggacccaggcaaagcctacacccagaccaccgtgttcaagtttctc
aataactag

DBGET integrated database retrieval system