KEGG   Pseudomonas syringae pv. phaseolicola 1448A: PSPPH_2648Help
Entry
PSPPH_2648        CDS       T00266                                 

Gene name
glgB
Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
psp  Pseudomonas syringae pv. phaseolicola 1448A
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PSPPH_2648 (glgB)
Enzymes [BR:psp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     PSPPH_2648 (glgB)
Exosome [BR:psp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSPPH_2648 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
3066785..3069010
Genome map
AA seq 741 aa AA seqDB search
MNAPHKTGTGRRAIPAAVDIDALIRAEHRDPFSILGPHGDGGSGQYVRAYLPAALSVRLL
AKDDGRELGEMEMSEVPGFFVGHLEQPQPYLLKVQWAGGEQITEDPYSFGPLLGEMDLYL
FAEGNHRDLSSCLGAQVTKVDGVDGVRFAVWAPNARRVSVVGSFNSWDGRRHPMRLRHPT
GVWEIFVPRLQPGEVYKYEILGAHGILPLKSDPMALATTLPPDTASKVSAPLQFEWNDQE
WLRSRTGRHDVAAPLSIYELHAGSWQMEQHEDGQWRQYNWRELADRLIPYVKELGFTHIE
LMPIMEHPFGGSWGYQLLAQFAPTARYGSPEDFAAFVDACHRAEIGVILDWVPAHFPTDT
HGLAQFDGTALYEYADPKEGFHQDWNTLIYNLGRTEVHGFMLASALHWLKHYHIDGLRVD
AVASMLYRDYSRNAGEWVPNRFGGRENIETIDFLRHLNDVVALEAPGTMVIAEESTAWPG
VSEPTQQGGLGFNYKWNMGWMHDSLQYMMRDPLHRRHHHSTLTFGLVYAWSERFVLPISH
DEVVHGKHSLIDKMPGDRWQKFANLRAYLSFMWTHPGKKLLFMGCEFGQWREWNHDEQLD
WYLMQYADHVGVKNLVGDLNRLYRQEKALHQRDADPAGFQWLIGDDQANSVFAYLRWSND
GEPLLVVANMTPVPRLAYRVGAPVSGAWTELLNSDAETYAGSNMGNGGEVNTEDEPAHGM
EASLKLNLPPLAVLILKPKKD
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcgcctcacaaaaccggcacaggccgccgcgcgattcccgctgctgtggacatc
gatgcgctgatccgcgctgaacaccgtgatcctttctcgatcctggggccgcacggtgat
ggcggcagcgggcaatacgttcgtgcctatctgcccgcagcgttgagcgtgcgtctgctg
gccaaagatgatggtcgtgagctgggcgagatggaaatgagcgaggtgccggggtttttc
gtcggtcatctcgagcagccacagccttaccttctgaaggtccaatgggctggcggtgaa
cagattaccgaggacccctacagcttcggtccgctgctgggcgagatggacctttatctg
tttgccgaaggcaaccaccgcgacctgagcagctgcctgggcgcgcaagtgaccaaagtc
gatggcgtcgacggtgtgcgctttgcggtctgggcgccgaatgcccgccgtgtgtcggtg
gtcggcagtttcaacagctgggatggtcgtcgtcacccgatgcgcctgcgtcacccgacc
ggcgtatgggagattttcgttccgcgtctgcagcccggtgaagtctacaaatacgagatc
ctcggtgcccacgggattctgccgctgaaaagcgaccctatggctctggccactacgctg
ccgcccgacaccgcgtcaaaggtctctgcgccactgcaattcgagtggaacgaccaggaa
tggctgcgatcacggacaggccgccacgatgttgccgcgccgctgtcgatctacgaactg
cacgcaggctcgtggcagatggagcagcacgaagacggtcaatggcgacagtacaactgg
cgcgagctggctgaccgcttgattccctatgtgaaggaactcggcttcacccacattgag
ctgatgccgatcatggagcacccgttcggggggtcatggggctatcagttgctggcccag
tttgcaccgactgctcgctacggttcgccggaagatttcgccgcgttcgttgacgcctgt
catcgggctgaaataggcgtgattcttgactgggtgcctgcgcatttcccgaccgatacc
cacggcctggcgcagttcgacggcaccgcgctgtacgagtacgccgaccctaaggaaggc
ttccatcaggactggaacacgctgatctacaacctggggcgcaccgaagttcacggcttc
atgctggcctcggcgttgcactggctcaagcattatcacattgacggtctgcgagtggat
gcagtggcttcgatgctgtaccgcgactattcgcgtaatgctggcgaatgggtgccgaat
cgctttggcggccgagagaatatcgaaaccatcgacttcctgcgtcatttgaacgacgta
gttgcgctggaagcccctgggaccatggttattgcggaagagtcgaccgcgtggccgggt
gtcagcgagccgacccagcagggtgggctaggcttcaactacaagtggaacatgggctgg
atgcacgattcgctgcagtacatgatgagggatccgttacatcgcaggcaccaccacagc
actctgactttcggcctggtgtatgcgtggtccgagcgtttcgtattgcctatttcccac
gatgaagtggtacacggtaaacattcgctgatcgacaaaatgcctggcgaccgctggcag
aaattcgccaacctgcgcgcctacctttcattcatgtggacgcaccctggcaagaagctg
ctgttcatggggtgcgagttcggccaatggcgcgagtggaatcatgacgagcaactggac
tggtacttgatgcaatacgccgaccacgttggcgtaaagaatctggttggcgatctgaat
cgcctctatcgtcaggaaaaggcgctgcaccagcgcgatgccgatccagccggcttccag
tggctgatcggcgacgaccaggccaacagcgtgtttgcctacctgcgctggagcaatgat
ggcgagccgctgctggtggtggccaacatgacgccagtgccgcgcctggcttatcgtgtg
ggcgcgccggtgtcaggtgcatggactgagttgctgaatagcgacgcggaaacctacgca
ggttctaacatgggcaatggtggggaagtgaacaccgaagacgagccagcacatgggatg
gaggcttctctgaaactgaacctgccgccgcttgccgtgctgatcctcaaaccgaagaaa
gactga

DBGET integrated database retrieval system