KEGG   Pseudomonas syringae pv. phaseolicola 1448A: PSPPH_2737Help
Entry
PSPPH_2737        CDS       T00266                                 

Definition
aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
psp  Pseudomonas syringae pv. phaseolicola 1448A
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psp00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    PSPPH_2737
Enzymes [BR:psp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     PSPPH_2737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3168747..3169430
Genome map
AA seq 227 aa AA seqDB search
MNNVQQQIVDLSRHLSRRGFFAATGGNLALRIDALHIAVTPSATDYFSMRPEDVCVLRLK
DLRQLSGERSPSVESELHAKVLRSRPDVNCSIHTHQPLACACTLFGKALDVPYPPPWKSL
GKRIQLVGYAPSGSGWLAGKLGRAIRSDHNVYLMRNHGVLCCGADIETTLTRLEDLETFC
RDHLVNQIKVNTRGKPESRAAVAHLINALTSSSSHALSPQTFSETQS
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatgtccaacaacagatcgtcgacctgtcgcggcacctctcacgccgcggcttc
ttcgccgccaccggcggcaaccttgcgctgcgtatcgacgcgctgcacatcgcggtcaca
ccgtcggccaccgattatttcagtatgcgaccggaggatgtctgcgttctgcgactcaag
gatctgcgccaactttcaggtgaacgttcgccttcggtggaaagcgagttgcacgccaaa
gtcctgcgcagccgcccggatgtcaattgcagtatccatacccaccaacccctggcctgt
gcctgcacattgttcggcaaagcgctggacgtgccttacccgccgccatggaagtcgctg
ggcaaacgcattcaactggtgggttatgcgccgtccgggtccggctggctggccggcaag
ctcggcagggccatacggtcagatcacaacgtttacctgatgcgcaatcacggcgttctg
tgttgcggtgcggatatcgaaaccaccctgacgcgcctggaggacctggaaacattctgc
cgtgatcatcttgtcaaccagatcaaagtcaatacccgtggaaaacctgagtcacgcgct
gcagtggcccacctgatcaatgccctgaccagttccagctcgcacgcactcagccctcag
actttttcagagactcaatcatga

DBGET integrated database retrieval system