KEGG   Pseudomonas syringae pv. phaseolicola 1448A: PSPPH_3210Help
Entry
PSPPH_3210        CDS       T00266                                 

Gene name
fadB
Definition
multifunctional fatty acid oxidation complex subunit alpha (EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8)
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
psp  Pseudomonas syringae pv. phaseolicola 1448A
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:psp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSPPH_3210 (fadB)
   01212 Fatty acid metabolism
    PSPPH_3210 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PSPPH_3210 (fadB)
   00650 Butanoate metabolism
    PSPPH_3210 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    PSPPH_3210 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    PSPPH_3210 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSPPH_3210 (fadB)
   00310 Lysine degradation
    PSPPH_3210 (fadB)
   00380 Tryptophan metabolism
    PSPPH_3210 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PSPPH_3210 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PSPPH_3210 (fadB)
   00281 Geraniol degradation
    PSPPH_3210 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    PSPPH_3210 (fadB)
Enzymes [BR:psp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PSPPH_3210 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PSPPH_3210 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PSPPH_3210 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     PSPPH_3210 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3720586..3722751)
Genome map
AA seq 721 aa AA seqDB search
MIYEGKAITVKALESGIVELNFDLKGESVNKFNRLTLNELRQAVDAIKADASVKGVIVSS
GKDVFIVGADITEFVDNFKLPEAELVAGNLQANRIFSDFEDLGVPTVVAINGIALGGGLE
MCLAADYRVISSSARIGLPEVKLGLYPGFGGTVRLPRIIGADNAIEWIASGKESSAEDAL
KVGAVDAVVAPEKLQAAALDLIQRAISGEFDYKAKRQPKLDKLKLNAIEQMMAFETAKGF
VAGQAGPNYPAPVEAIKTIQKAANFGRDKALEIEAAGFVKMAKTSAAQSLIGLFLNDQEL
KKKAKGYDAVAKDVKQAAVLGAGIMGGGIAYQSAVKGTPILMKDIREEAIQLGLNEASKL
LGGRLEKGRLTAAKMAEALNAIRPTLSYGDFGNVDLVVEAVVENPKVKQAVLAEVEANVG
EHTILASNTSTISISLLAKALKRPENFVGMHFFNPVHMMPLVEVIRGEKSSEEAVATTVA
YARKMGKNPIVVNDCPGFLVNRVLFPYFGGFARLVSAGVDFVRIDKVMEKFGWPMGPAYL
MDVVGIDTGHHGRDVMAEGFPDRMKDDRRSVVDALYEAKRLGQKNGKGFYAYETDKKGKP
KKVNDPAVLDVLKPIVYEQREVSDEDIINWMMIPLCLETVRCLEDGIVETAAEADMGLIY
GIGFPPFRGGALRYIDSIGVAEFVALADQYAELGALYQPTAKLREMASKGQSFFGQASSE
E
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgaaggtaaagccatcacggttaaggctcttgaaagtggcatcgtcgaattg
aatttcgatctcaagggtgagtccgtcaacaagttcaaccgcctcaccctcaatgaattg
cgtcaggcagtcgatgcaatcaaggccgatgcctcggtcaagggcgtgatcgtcagcagt
ggcaaggacgtgttcatcgtcggtgccgacatcaccgagttcgtcgacaacttcaagttg
cccgaagccgaactggttgcgggcaatctgcaagccaacaggattttcagcgatttcgaa
gatctgggcgtccccaccgttgtcgctattaacggcattgcgctgggcggcggtctggaa
atgtgcctggccgcagactatcgggtcatctccagcagtgctcgcatcggtctgcccgaa
gtcaagctgggcctataccctggtttcggcggtactgtgcgtttgccgcgcatcatcggt
gctgacaacgcaatcgaatggatcgcgtcaggcaaggaaagctccgcagaggatgctctg
aaggttggtgccgttgatgcggtagttgcacccgagaagcttcaggccgcggcccttgac
ctgattcagcgcgccatttccggcgagttcgactacaaggccaagcgccagcccaagctg
gacaagctcaagctcaatgccatcgagcaaatgatggcattcgaaaccgccaaaggtttt
gtcgcaggtcaggccggaccgaactatccggcaccggtcgaggcgatcaagaccatccag
aaagccgccaatttcggtcgtgacaaggcgctggaaatcgaagccgccggtttcgtgaaa
atggccaagacatctgctgcgcagagccttatcggcctgtttctgaacgatcaggaactg
aaaaagaaagccaagggctacgacgcagtcgccaaggacgtgaaacaggccgccgtactg
ggcgccgggatcatgggcggcggcattgcctatcagtcggcagtcaagggcacgccgatc
ctgatgaaggatatccgcgaagaagccattcaactgggtctgaacgaagcctccaaactg
cttggtggtcgcctggaaaaaggccgtctgactgcggcgaagatggccgaagcgcttaac
gcgattcgtcctacgctttcctacggcgatttcggcaacgtcgacctggtggtcgaagcg
gttgtcgaaaacccgaaggtcaagcaggcggtactggcggaagtcgaagccaacgtgggt
gagcacaccattctggcgtccaacacttcgaccatctcgatcagcttgctggccaaggcc
ctcaagcgtccggaaaacttcgtcggcatgcacttcttcaacccggtgcacatgatgccg
ctggtggaagtgatccgtggcgagaagtccagcgaagaagcggttgccacgaccgttgcc
tacgccaggaaaatgggcaagaacccgattgtggtcaacgactgcccgggctttctggtc
aaccgcgtactgtttccgtacttcggcggttttgccaggctggtcagcgcaggcgtggat
ttcgtgcgcatcgacaaggtcatggagaaattcggctggccgatggggcctgcctacctg
atggacgttgtcggtatcgacaccggccaccatggccgtgatgtcatggccgaaggtttc
cctgaccggatgaaggatgatcgccgctctgtggttgacgcgctgtatgaagccaaacgt
ctgggacagaagaacggcaagggcttctatgcctacgagaccgacaagaagggcaagccc
aagaaggtcaatgacccggctgtgctggatgtgctcaagccgatcgtttacgaacagcgt
gaagtgagcgatgaagacatcatcaactggatgatgatcccgttgtgcctggaaacggtt
cgctgcctggaagacggcatcgtcgaaaccgctgccgaagccgacatgggcctgatctac
ggtattggtttccctccattccgtggcggtgcgctgcgctacatcgactccatcggtgtt
gccgaattcgttgccctggctgaccaatacgccgagctgggtgccctgtatcaaccgacc
gcgaagctgcgtgaaatggccagtaaaggccagagcttcttcggtcaagcgtcttccgag
gaatga

DBGET integrated database retrieval system