KEGG   Pseudomonas savastanoi pv. phaseolicola 1448A: PSPPH_3690Help
Entry
PSPPH_3690        CDS       T00266                                 

Definition
(GenBank) glutathione peroxidase family protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
psp  Pseudomonas savastanoi pv. phaseolicola 1448A
Pathway
psp00480  Glutathione metabolism
psp00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:psp00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PSPPH_3690
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PSPPH_3690
Enzymes [BR:psp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PSPPH_3690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AAZ33184
UniProt: Q48FK4
Position
complement(4238565..4239116)
Genome map
AA seq 183 aa AA seqDB search
MNIRFVSIPLLLLAMSGAAMAADCPPLLQGELPKLRAKENIDLCKRFAGKPLVVVNTASF
CGFAPQFKGLEELSQRYKGQGLEVLGVPSNDFKQEAKDGEETAKVCYVNYGVTFTMTEPQ
AVRGDDATHLFKVLAEQSSAPRWNFYKYVVDRQGKVIANFSSMTKPDDPELIAAIEKAIA
SKP
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcgctttgtttcgatacctcttctgctgctggccatgagtggcgctgcaatg
gctgccgactgtccgccgctgctgcagggcgagttgcccaagctgcgcgccaaggaaaac
atcgacctgtgcaaacgctttgccggcaagccgctggtggtggtcaacaccgccagtttc
tgtggctttgccccgcagttcaaagggcttgaagagctgagtcagcgctacaaggggcag
gggcttgaggtgttgggcgtgccgtccaatgacttcaaacaggaagccaaggatggtgag
gagaccgccaaggtttgctacgtcaattacggcgtgactttcaccatgaccgagccgcag
gccgtacgcggcgatgatgcgacccatttgttcaaggtgctggccgagcaaagcagtgcg
ccgcgctggaatttctacaagtacgtggttgatcgccagggtaaagtcattgccaacttc
tccagcatgaccaagccggatgatcctgagctgatcgcagccattgaaaaggcgattgcg
tcgaagccttag

DBGET integrated database retrieval system