KEGG   Pseudomonas syringae pv. phaseolicola 1448A: PSPPH_3773Help
Entry
PSPPH_3773        CDS       T00266                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
psp  Pseudomonas syringae pv. phaseolicola 1448A
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:psp03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(4322832..4323440)
Genome map
AA seq 202 aa AA seqDB search
MIGRLRGSLAEKQPPHLVLDVNGVGYELEVPMTTLYRLPHVGETVTLHTHLVVREDAHLL
YGFYEKRERELFRELIRLNGVGPKLALALMSGLEVDELVRCVQAQDTSALTRIPGVGKKT
AERLLVELKDRFKAWESLPGTFTLVSNGPNQAEPVASAESDAVSALISLGYKPQEASKAV
SAIKEKDLSSADLIRRALKGMG
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgattggacgtttgcgcggctctctcgccgaaaaacagcctccgcatctggtgttggat
gtcaatggtgtcggctatgagctggaagtgccgatgacgacactgtatcggttgccgcat
gtcggcgaaacagtgacattgcacacccatctggtggtccgcgaggacgcgcatctgttg
tatggcttctatgaaaaacgcgagcgcgagctgttccgtgaattgatccgactcaacggg
gttggccccaagctggcgctggcgttgatgtccggcctggaagttgatgagctggtgcgt
tgcgttcaggcgcaggacacatcggcgctgactcgtattcccggtgtaggcaagaaaacc
gccgagcgtctgctggtcgagctcaaggatcggttcaaggcatgggaatccttgccaggc
acctttacgctggtttccaatggtccgaatcaggccgagcctgtggcatcggccgaatcc
gatgcagtcagcgcgctgatttcactgggttacaaaccgcaggaggcgagcaaggcggtc
tccgccatcaaggaaaaagatttgagcagtgcggatctgattcgccgtgcgttgaagggg
atgggttaa

DBGET integrated database retrieval system