KEGG   Pseudomonas syringae pv. phaseolicola 1448A: PSPPH_3850Help
Entry
PSPPH_3850        CDS       T00266                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
psp  Pseudomonas syringae pv. phaseolicola 1448A
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:psp01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:psp00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
4406710..4407861
Genome map
AA seq 383 aa AA seqDB search
MTAPTDLSPTLQLACDLIRRPSVTPVDADCQAVMMQRLGNAGFKLEPMRIEDVDNFWATH
GTTDGPVLCFAGHTDVVPTGPVENWQNDPFDALIDEHGMLCGRGAADMKGSLAAMLVAAE
RFVADHPNHKGSVAFLITSDEEGPAHHGTKAVVERLAARKERLDWCIVGEPSSTTLVGDV
VKNGRRGSLGATLTVRGKQGHVAYPHLAKNPIHLAVPALAELAAEHWDHGNDFFPPTSFQ
ISNLNAGTGATNVIPGDLVAVFNFRFSTESTVEGLQQRVAAILDKHELDWHVNWALSGLP
FLTEPGALLDAVSSSIKSVTGRDTKASTSGGTSDGRFIATLGTQVVELGPVNATIHQVNE
RILASDLDVLTEIYYQTLVKLLA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgactgcccctaccgacctgtcgcccacccttcaacttgcctgcgatctgatccgccgc
ccatcagtgacgccggtcgatgccgactgtcaggcagtgatgatgcaacgcctgggcaat
gccggcttcaagctggagcccatgcgtatcgaagacgtcgataacttctgggccacacac
ggcactaccgacggcccggtactgtgtttcgcaggtcatacggacgtggtccctaccggc
ccggtggagaactggcagaacgacccgttcgatgcgttgatcgacgagcacggcatgctc
tgcggacgcggtgcagcggacatgaaaggcagcctggcagccatgctcgtggccgccgag
cgctttgtagccgatcacccgaatcacaagggttcggtggcattcctgatcaccagtgac
gaagaaggcccggcgcaccacggtaccaaggctgtcgtcgaacgtctggcagcgcgcaag
gagcgtctggactggtgcatcgtcggcgaaccttcgagcaccacgctggtgggcgatgtg
gtcaagaacgggcgtcgtggctcgctgggcgccaccctcaccgtgcgcggcaaacagggc
catgtggcttacccgcatctggcgaagaaccctattcaccttgcagttccggcacttgcc
gaactggctgcagagcactgggaccatggcaacgatttcttcccgccaaccagcttccag
atctccaacctgaacgccggcacgggtgcaaccaatgtcatcccgggtgatctggtggca
gtattcaacttccgtttttcgaccgagtcgaccgtcgaaggcttgcagcagcgtgtcgcc
gccatcctcgacaagcatgagctggactggcatgtgaactgggcgttgtccggcctgccg
ttcctgaccgagccgggcgcattgctggacgccgtgtcgtccagcatcaaaagcgtcacg
ggccgtgacaccaaagcctcgaccagcggcggaacctccgacggccgtttcatcgcgacc
ctgggtacgcaagtggttgaactggggccggtcaacgcgacgattcaccaggtcaacgag
cggattctggccagcgatctcgacgtgctgaccgagatctactaccagaccctggtcaag
ttgctcgcctga

DBGET integrated database retrieval system