KEGG   Pseudomonas syringae pv. phaseolicola 1448A: PSPPH_4180Help
Entry
PSPPH_4180        CDS       T00266                                 

Definition
Tat pathway signal sequence domain-containing protein (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
psp  Pseudomonas syringae pv. phaseolicola 1448A
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:psp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PSPPH_4180
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    PSPPH_4180
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PSPPH_4180
Enzymes [BR:psp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PSPPH_4180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(4764900..4766474)
Genome map
AA seq 524 aa AA seqDB search
MSQFDLKRRRVIQAVGAGLLLPGLAPAVIASVQDRPKMVDGVQSGDVLGDKAMVWSRSDR
PSRMVVEWDTRSMFTQPRRVVSALADPRTDFTARVELSGLPVDQAIFYRVSFEDAQSGVA
SEPWFGHLRSTPQQRRDIRFVWSGDTVGQGFGINPDIGGMRIYEAMRLRLPDFFIHSGDT
IYADGPVPEQITTEGGRIWRNLTTEAKSKVAETLDEYRGNYRYNLMDENLRRFNAEVPQI
WQWDDHEVTNNWSPSKQLDERYKVKDIQLLSSRARQAYLEYAPLRLQQADNGGRIYRKIP
YGPMLDVFVLDMRSYRDGNDANLAEKPGPTTAFLGREQLDWLKRELNASRAQWKVIAADM
PIGLGVPDGEVSPGVARWEAIANGNDGPALGRELEVAELLAYLRAQKIRDCIWLTADVHY
CAAHHYQPDRAVFQDFDPFWEFVAGPLNAGSFGPNVLDKTFGPELVFQKAPPAQNTSPFA
GYQFFGEVNIDGQTGEMSVALRDLDGVSVFERKLQPTVEVSRIV
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
gtgagccagttcgatctcaagcgtcgccgtgtcatccaggccgtgggggccggtttgctg
ttgccggggcttgcgcctgcggtgatcgcttcggtgcaggaccgtccgaaaatggtcgat
ggtgtgcagtccggagatgtactcggcgacaaggctatggtctggagccgcagcgaccgg
ccttcgcggatggtggtcgaatgggacacacgcagtatgtttacccagccacggcgcgtg
gtctcggcgctcgccgatccgcgtaccgacttcactgcgcgggtcgagttgagcgggctg
ccggtcgatcaggcgattttctaccgcgtctcgttcgaggatgcccagagcggtgtcgcc
agcgagccctggttcggccatctgcgcagcacgccccaacagcgtcgtgacatccgcttc
gtctggagtggcgacacggtggggcagggcttcggcatcaaccctgacattggtggcatg
cgtatctatgaggcgatgcgcttgcgcttgccggacttttttatccacagcggtgacacc
atttacgccgacgggccagtgcccgagcagatcaccacggaaggcgggcggatctggcgc
aacctgaccaccgaggcgaaaagcaaggtggcggagaccctcgacgagtaccgaggcaat
taccgctataacctgatggatgaaaatctgcgccgcttcaacgcagaagtgccgcagatc
tggcaatgggatgaccacgaagtcaccaacaactggtcgcccagcaagcagcttgatgag
cgttacaaggtcaaggatatccagctgctgtcctcgcgtgcccgccaggcttatctggag
tacgcgccgctgcgcttgcagcaagccgacaatggcggacgcatttatcgcaagattccc
tacggtccgatgctcgacgtttttgtcctcgatatgcgcagctaccgcgacggcaatgat
gccaatctggccgaaaaaccgggtccgaccaccgcatttcttggtcgtgagcaacttgac
tggctcaagcgcgaactcaatgcgtcgcgcgcgcaatggaaggtcattgctgctgacatg
cccatcggccttggcgtaccggatggcgaggtgagccccggtgtggcgcgctgggaagcc
atcgccaacggcaatgacggaccggcgcttggccgcgagctggaggttgccgaattgctg
gcgtacctgcgcgcgcagaagattcgcgactgtatctggctgacggccgatgtccattac
tgcgccgcgcatcattaccagccggatcgtgccgtgtttcaggacttcgacccgttctgg
gaattcgtcgccgggccgctgaatgcgggcagcttcggtcccaatgtactggacaagacg
ttcggtccggaactggtgttccagaaggcgccccctgcacagaacacttcgccttttgcg
ggttatcagttctttggcgaagtgaacatcgacgggcagaccggcgagatgtctgttgcc
ctgcgcgatcttgacggcgtttcagtgttcgagcgcaaattgcagccgaccgtggaggtt
agccgcattgtctga

  All links  
No link information was found.   
DBGET integrated database retrieval system