KEGG   Pseudomonas syringae pv. phaseolicola 1448A: PSPPH_4195Help
Entry
PSPPH_4195        CDS       T00266                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
psp  Pseudomonas syringae pv. phaseolicola 1448A
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:psp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSPPH_4195 (tpiA)
   01230 Biosynthesis of amino acids
    PSPPH_4195 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSPPH_4195 (tpiA)
   00051 Fructose and mannose metabolism
    PSPPH_4195 (tpiA)
   00562 Inositol phosphate metabolism
    PSPPH_4195 (tpiA)
Enzymes [BR:psp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PSPPH_4195 (tpiA)
Exosome [BR:psp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PSPPH_4195 (tpiA)
  Exosomal proteins of bladder cancer cells
   PSPPH_4195 (tpiA)
  Exosomal proteins of melanoma cells
   PSPPH_4195 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(4781444..4782199)
Genome map
AA seq 251 aa AA seqDB search
MRRPMVAGNWKMHGTRASVAELIEGLGKQVLPGSVDIAVMPASLFTNQVIEGLRATSIIV
GAQDAAIQAEQGALTGEIASSQLADAGCKLVLVGHSERRQLIGEQDDVLNKKFAAIQASG
LTPVLCIGETLEERKAGQTLEVVGRQLDSVIAEFGVSALINAVIAYEPVWAIGTGLTASP
QEAQEVHAAIRAHLAKENAEVAQGVRLLYGGSVKAANAVELFSMPDIDGGLIGGASLNAD
EFGAICRAAGN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgcccaatggtagctggtaactggaaaatgcacggtacccgcgccagcgtcgct
gagctgatcgagggtttgggcaagcaggtgttgccaggcagcgtcgatatcgccgtaatg
cctgcaagtctgtttaccaatcaggtgatcgaagggcttcgggcaacgtcgatcattgtc
ggtgcgcaggatgcagccattcaggctgagcagggcgcgctgaccggtgagatcgcgtcg
agtcagctggctgatgcaggttgcaaactggtacttgtcgggcactccgaacgtcgtcag
ctaattggcgagcaggatgatgtgcttaacaagaagtttgcggcgatccaggcaagcggg
ctgacacctgtgctttgcataggcgaaacgcttgaagagcgcaaggcagggcagacgctt
gaagttgtcgggcgtcagctggacagtgtcatcgccgagtttggcgtcagcgcactgatc
aatgccgtaattgcctacgagccggtctgggccattggcaccggattgactgcttcgcct
caagaggcgcaggaagtgcacgcagcaatccgtgcgcatctggcaaaagagaatgccgaa
gtcgcacaaggcgtgcgacttctctatggcggcagcgtgaaggcggccaatgcggtcgag
ctcttcagcatgccggatatcgatggggggctcattggtggagcttccctgaatgcagat
gagttcggtgcgatctgtcgcgccgcgggaaactga

  All links  
No link information was found.   
DBGET integrated database retrieval system