KEGG   Pseudomonas syringae pv. phaseolicola 1448A: PSPPH_4536Help
Entry
PSPPH_4536        CDS       T00266                                 

Definition
glycosyl hydrolase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
psp  Pseudomonas syringae pv. phaseolicola 1448A
Brite
Enzymes [BR:psp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     PSPPH_4536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5170444..5171556
Genome map
AA seq 370 aa AA seqDB search
MRRANRRSFLTAFVRLLACLPFVNSRLLAAETFATLRQPAAEKGIRFGFAVDPAKLNDDA
AYRQLVARHASIVVPENALKWQTVHPEPERYNFASADAIAGFAKAHEQRMRGHTFCWHRS
LPDWIHQTVTPTNAEAVLTAHISTVASHYRGLISAWDVVNEAIQLEDGQPDGLRNSFWYQ
MLGPRYLDIAFKAAHKADPDALLCYNDYGLEKDTHYGESKRTAVLALLRGLKQRGIPIHG
LGIQSHLRAGDIFGPGLSRFILAVRDMGLSIHITELDVDDGHLTGSIAERDGSVAATYKR
YLDVVLATRSVSTVITWGVWDSPHVAGATASNGPLAQRALAFGPRGEVKPASWVIAHCFE
DAQMQMDARI
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgggctaatcgacgcagttttctgactgcgtttgtccgcctgctggcgtgcctg
cccttcgtcaacagcaggctgctggcggcagaaacctttgccacattgcgccagcctgca
gccgagaaaggtatccggttcggctttgcggttgatccggcaaagctgaatgacgatgcg
gcctatcggcaactggtcgcccgtcatgccagcatcgtagtgccagaaaacgccttgaag
tggcagaccgtccaccccgaaccagagcgttacaacttcgcatccgccgacgcaatcgcg
gggtttgcgaaagcgcatgaacagcgtatgcgcggccacactttctgctggcatcgctct
ttacccgactggattcaccaaaccgtcaccccgacgaacgccgaagcggtgctgacggcg
cacatcagtaccgtcgccagccattatcgcggtctcatcagcgcatgggacgtcgtcaac
gaagccatccagctggaggatggccagcctgacgggctgcgtaattcattctggtatcag
atgctcgggcctcgctatctggacatagccttcaaggctgcgcacaaggccgacccggac
gccctgctctgctacaacgattacggcctggaaaaggatacccattacggcgaaagcaaa
cgcactgccgtgctcgccctgctgcgcgggctcaagcagcgcggcattccgatacacggc
ttgggcattcagtcccacctgcgtgcaggcgacatatttggtccgggcctttcccgcttt
attcttgcagtgcgtgatatggggttgtcgatccacatcacggaactggacgtcgacgac
ggccacttgacggggtctatcgcagaacgcgatggatcagttgcagcgacttataagcgg
tatctcgacgtagtgcttgccacgcgctcggtatctaccgttattacgtggggtgtttgg
gacagcccgcatgttgcaggcgccacggccagcaacgggccgttggcacagcgggcattg
gcgtttggcccgcgaggtgaggtgaagccggcgagctgggtgatcgcgcattgtttcgaa
gacgcgcaaatgcagatggatgcgcggatttag

DBGET integrated database retrieval system