KEGG   Pseudomonas syringae pv. phaseolicola 1448A: PSPPH_4734Help
Entry
PSPPH_4734        CDS       T00266                                 

Gene name
glcB
Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
psp  Pseudomonas syringae pv. phaseolicola 1448A
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSPPH_4734 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSPPH_4734 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    PSPPH_4734 (glcB)
Enzymes [BR:psp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PSPPH_4734 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5371994..5374171
Genome map
AA seq 725 aa AA seqDB search
MTEYVQVGDLQVARVLFDFVQNEATPGTGIDATSFWAGADQLIHDLAPKNKALLAKRDEL
QAQIDTWHQSRAGQAHDASAYKAFLQEIGYLLPEAADFQITTQNVDEEIATMAGPQLVVP
VMNARFALNASNARWGSLYDALYGTDAISEEGGAEKGKGYNKVRGNKVIAFARAFLDQAA
PLAAGSHVDSTAYKLIDGRLVISLKGGSNTGLRDDAQLVGFQGEASAPFAVLLKHNGLHF
ELQIDASSPVGQTDAAGVKDILMEAALTTIMDCEDSIAAVDADDKVVVYRNWLGLMKGDL
AESVSKGGETFTRTMNPDRVYTTPQGGEVTLHGRSLLFIRNVGHLMTIDAILDKHGNEVP
EGILDGLLTSLAAIHNLNRNTSRSNSRSGSMYIVKPKMHGPEEAAFTNELFGRIEQVLGL
PRNTLKVGIMDEERRTTVNLKACIQAASERVVFINTGFLDRTGDEIHTSMEAGPVVRKAQ
MKAEKWISAYENSNVDIGLKCGLQGRAQIGKGMWAMPDLMAAMLEQKIAHPLAGANTAWV
PSPTAAALHALHYHKVDVFARQAELAQREQASVDDILTIPLAPNTDWTPEEIQNELDNNA
QGILGYVVRWIDQGVGCSKVPDINDIGLMEDRATLRISSQHMANWLRHGVVSEAQVLESL
KRMAPVVDRQNANDPLYRPLAPDFDSNIAFQAAVELVIEGTRQPNGYTEPVLHRRRREFK
AKKGM
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgactgagtacgttcaagtcggtgacctgcaagtcgccagagtcctgttcgacttcgtg
cagaacgaagccacacccggaaccggcatcgacgccacttcgttctgggcgggtgcggac
caactgatccacgaccttgcgccaaagaataaggcactgctcgccaaacgagatgaattg
caggcgcagatcgacacgtggcaccaatcgcgcgccggacaggctcacgacgcctcggct
tacaaagccttccttcaggagatcggctacctgctgccagaagcagcggacttccagatc
accacgcaaaacgtcgatgaagaaatagccaccatggccggaccgcaactggtcgtgcct
gtaatgaacgcacggtttgcgctcaatgcgtcaaatgcccgctggggctcgctgtatgac
gcgctctatggcaccgatgccatcagcgaagaaggcggcgcggagaaaggcaagggctac
aacaaggtgcgtggcaataaggtgatcgccttcgcccgcgcattcctcgatcaggcagcc
cctttggcggctggctcgcacgttgattcgactgcttacaaattgatcgacggcagactg
gtcatcagcctcaagggcggcagcaacacgggcctgcgcgacgatgcacaactggtgggt
tttcagggtgaggcttcagcgccgttcgccgtgctgctcaaacacaatggcctgcatttc
gaattgcagatcgacgcttccagcccggttggccaaaccgatgcggcaggcgtgaaagac
atcctcatggaagccgcgctgaccaccatcatggattgcgaagactccattgcagccgtc
gatgccgacgacaaagtagtcgtctaccgcaactggctaggcctgatgaaaggcgacctg
gcggaatcggtgtccaaaggcggcgaaaccttcacccgcaccatgaacccggatcgcgtc
tacaccacgccgcaaggcggcgaagtcacgctgcacggtcgttcgctgctgttcattcgt
aacgtaggtcacttgatgaccatcgacgcgattctcgacaagcatggcaatgaagtgccg
gaaggtattctcgatggcctgttgaccagtctggctgcgatccacaacctcaaccgcaat
acctcgcgcagcaacagccgcagcggctcgatgtacatcgtcaaaccgaagatgcacggg
ccggaggaagccgcgtttaccaacgaactgttcgggcgtatcgagcaggtgctgggcttg
ccgcgcaacacattgaaagtcggcatcatggacgaagagcgccgtaccacggtcaacctc
aaagcctgtattcaggcagccagcgagcgcgtggtattcatcaacaccggcttcctcgac
cgcaccggtgacgaaatccatacctcgatggaagcgggcccggtggtgcgcaaggcgcag
atgaaagccgagaaatggatcagtgcctacgagaactccaacgtcgacatcggcctgaaa
tgcggcctgcaaggtcgcgcacagatcggcaaaggcatgtgggccatgcccgacctgatg
gccgccatgctggaacagaaaatcgctcacccgctggctggcgcaaacactgcatgggtg
ccctcgcctacagcggctgcgctacacgccctgcattaccacaaggtcgatgtattcgct
cgccaggccgaactggctcaacgcgagcaggcatcggtggatgacattctgaccattccc
cttgcgccgaacaccgactggacgcccgaagaaatccagaacgaactggacaacaacgca
cagggcattctcggctatgtggtgcgctggatcgatcagggtgtaggttgctcgaaagta
ccggatatcaacgacatcggcctgatggaagaccgcgcaacgctgcgcatctcaagccag
cacatggccaactggctgcgtcacggcgttgtcagcgaagctcaggtgctggaaagcttg
aagcgcatggcaccggtcgtggatcgccagaatgccaatgacccgctgtatcgcccgctg
gcgccagacttcgacagcaacattgccttccaggcagccgtcgaactggtgatcgaaggt
acgcgacagcctaacggctataccgagccggtactgcatcgtcgccgtcgtgagttcaag
gccaaaaaaggaatgtaa

DBGET integrated database retrieval system