KEGG   Pseudomonas syringae pv. phaseolicola 1448A: PSPPH_4756Help
Entry
PSPPH_4756        CDS       T00266                                 

Gene name
fdhA2
Definition
glutathione-independent formaldehyde dehydrogenase (EC:1.2.1.46)
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
psp  Pseudomonas syringae pv. phaseolicola 1448A
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:psp01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:psp00680]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:psp00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
5400301..5401500
Genome map
AA seq 399 aa AA seqDB search
MSGNRGVVYLGAGKVEVQSIPFPKMEDPRGKRIEHGVILRVVSTNICGSDQHMVRGRTTA
QTGLVLGHEITGEVLEAGRDVEHLKVGDLVSVPFNVACGRCRSCKEQNTGVCLTVNPARP
GGAYGYVDMGDWVGGQAEYVLVPYADFNLLKLPDRDAAMEKIRDLTCLSDILPTGYHGAV
TAGVGPGSTVYVAGAGPVGLAAAASARLLGAAVVIVGDVNPKRLVHAKAQGFEIADLSLD
TPLHEQIAALLGEPEVDCAIDAVGFEARGHGHAGAQAEAPATVLNSLMGVVRVAGKIGIP
GLYVTEDPGAVDAAAKMGSLSIRFGLGWAKSHSFHTGQTPVMKYNRQLMQAIMWDRIKIA
DVVGVEVISLDDAPRGYGEFDSGVPKKFVIDPHRLFGAV
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtaatcgcggtgtagtgtatctcggcgctggcaaggtcgaagtgcaatcaatc
cccttcccgaaaatggaagacccacgcggcaagcgcatcgaacacggcgtgatcctgcgc
gtagtctccaccaatatctgcggctcggaccaacacatggtgcgtggtcgcacgacggcg
caaaccgggttggtcctgggtcatgaaatcaccggcgaggtgctggaagccgggcgcgac
gtggaacatctgaaagtcggtgatctggtttctgtgccgttcaacgtggcgtgcggtcgc
tgccgcagttgcaaggaacagaacactggcgtctgcctgacggtcaacccggcccgcccc
ggcggtgcatacggctacgtcgacatgggcgactgggtcggcggtcaggctgaatacgtg
ctggtgccttacgctgacttcaacctgctcaaactgccagaccgcgacgcggcgatggag
aaaatccgcgacctgacctgcctgtccgacatcctgcccaccggctaccacggtgcagtg
actgccggggttggccctggcagcacggtttacgtagcaggcgctggcccggtcggcctg
gctgcggcggcgtcagcacgcttgttgggcgcggcggtggtaatcgtcggcgacgtcaac
ccgaaacgcctggtccacgccaaggcccaaggcttcgaaattgctgacctgtccctggac
acgccactgcacgaacagatcgctgccctgctcggcgagcctgaagtggattgcgccatc
gacgccgtaggcttcgaagcacgcggtcacggccatgctggcgctcaggccgaagcaccc
gccaccgttctcaactcgttgatgggcgtagtgcgcgtcgcaggcaagatcggcatcccc
ggcctgtacgtcaccgaagacccaggtgccgtagacgctgccgcaaaaatgggcagcctg
agcattcgcttcggcctgggctgggccaaatcccacagcttccacaccggccagaccccg
gtcatgaaatacaaccgccagctgatgcaggccatcatgtgggaccgcatcaagatcgcc
gatgtggtgggtgtagaggtgatcagtctggatgatgcgccgcggggttatggggagttt
gattcgggcgtgccgaagaagtttgtgattgatccgcatcggttgtttggtgctgtgtag

DBGET integrated database retrieval system