KEGG   Pseudomonas syringae pv. phaseolicola 1448A: PSPPH_4771Help
Entry
PSPPH_4771        CDS       T00266                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
psp  Pseudomonas syringae pv. phaseolicola 1448A
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:psp00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:psp00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
5417325..5417837
Genome map
AA seq 170 aa AA seqDB search
MKTHLPLSLIAALGENRVIGVDNSMPWHLPGDFKYFKATTLGKPIIMGRKTWDSLGRLLP
GRLNLVVSRQTDLQLEGAEVFASLDAAVVRAEQWAQEQGVDEVMLIGGAQLYAQGLPEAD
RLYLTRVALSPDGDAWFPEFDTAQWALVSNIENAAVDDKPAYNFEVWERV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactcatctcccccttagcctgattgccgcccttggtgaaaaccgagtgatcggc
gtcgacaattccatgccctggcatttgccgggggatttcaaatacttcaaggccacgacg
ctcggcaagccgatcatcatgggtcgcaagacctgggattcgctgggccgcctcctgccc
ggtcgcctgaacctggtggtcagccgccagactgatttgcagcttgaaggcgcggaagtc
ttcgcttcgctggacgccgccgtcgtgcgcgccgagcagtgggcgcaggaacagggtgtc
gacgaggtgatgctgatcggcggcgcgcagctttatgcccagggccttcccgaggcggat
cgcctgtacctgactcgcgtggcactgagccctgatggcgacgcgtggtttcctgaattc
gatacggcgcagtgggcgctggtatccaacatcgaaaacgccgccgtcgatgacaagcct
gcctacaacttcgaagtgtgggaacgcgtctga

DBGET integrated database retrieval system