KEGG   Pseudomonas syringae pv. phaseolicola 1448A: PSPPH_5126Help
Entry
PSPPH_5126        CDS       T00266                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
psp  Pseudomonas syringae pv. phaseolicola 1448A
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:psp00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
5815218..5816129
Genome map
AA seq 303 aa AA seqDB search
MPTSPVEPNVESVQYDELNCWRIRHGEAELLVAQQGAHILSYQVAGQQPLVWLNEEAVFK
QGKPIRAGMPICWPWFGNLERNPQSVQAMRDSSEPAKAHGEVRALDWQLLGIGADGDALL
VEFVLPEAEGHLPGWPHNVALKLSIRLDHALNVSLVSYNCGTESVVISQALHTYFAVSDV
RQVSVEGLDGLRYIETLANWEEREQAGDLTFTGETDRIYKDTPGVLSIVDPQWQRRIHIR
STGSKSAILWNPWIEKTGKFTDMAADGWQRMVCVETANVLDDVVTLAPDQMHVLGVSIWS
EAL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgccaacatccccggttgaacccaacgttgaatctgtccagtacgacgaactgaactgc
tggcgtattcgccacggcgaagcagagctgctggttgcgcagcagggcgcgcatatcctc
agctatcaagtggccggacagcagcctctggtgtggctgaatgaagaggcggttttcaag
caaggcaaacccattcgcgcgggcatgcccatctgctggccgtggttcggtaacctggaa
cgcaacccgcaaagcgtgcaggcaatgcgcgacagcagcgaacctgccaaggcgcatggt
gaagtgcgagcgctggattggcagttgctggggatcggagcagatggcgatgcactgctg
gtggagttcgtccttccggaagccgaaggccacctgccaggctggccgcacaacgtcgcc
ctgaaactcagcatccgtctggaccatgccctgaacgtcagcctggtcagctacaactgc
ggcacagaatctgtcgttatcagccaggcgctgcacacctatttcgccgtcagcgatgtt
cgtcaggtcagcgtcgaagggctagacggcctgcgctacatcgaaaccctggcaaactgg
gaagaacgtgaacaggccggcgacctgacgttcactggcgaaaccgaccgtatctacaag
gatacgccgggtgtgctcagcatcgttgacccccaatggcagcgccgcatccatatccgc
agcaccggctcgaaatcagccatcctgtggaacccgtggatcgagaaaaccggtaaattc
accgacatggcagcagatggctggcagcgcatggtctgcgtcgaaacggccaacgtgctg
gacgatgtggtgacgctggcccccgaccagatgcatgttctgggtgtgagtatctggagc
gaggcgctctga

DBGET integrated database retrieval system