KEGG   Pseudohongiella spirulinae: PS2015_2591Help
Entry
PS2015_2591       CDS       T04158                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pspi  Pseudohongiella spirulinae
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:pspi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PS2015_2591
   00630 Glyoxylate and dicarboxylate metabolism
    PS2015_2591
   00640 Propanoate metabolism
    PS2015_2591
   00650 Butanoate metabolism
    PS2015_2591
  Lipid metabolism
   00071 Fatty acid degradation
    PS2015_2591
   00072 Synthesis and degradation of ketone bodies
    PS2015_2591
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PS2015_2591
   00310 Lysine degradation
    PS2015_2591
   00380 Tryptophan metabolism
    PS2015_2591
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PS2015_2591
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PS2015_2591
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PS2015_2591
Enzymes [BR:pspi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PS2015_2591
Exosome [BR:pspi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PS2015_2591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2811576..2812871
Genome map
AA seq 431 aa AA seqDB search
MYNSENHSNTLRKVVIAGGVRIPFCRSNSVYAELSNLDMLADTLQMLSTRFSLAGKKIDE
VVAGAVTSHSKDWNLAREALLSTELSPATPGITLQMACGTSLQAALMSAAKIATGQIDCA
IAAGTDTTSDAPIVFKRRFAHRLLKVSQARNMKARLAALKGFRLSELAPQAPANGEPRTG
LAMGEHCELMAHEWGVTRQEQDQLALESHLKAAAAYDAGFFDDMVQMYEGVARDNNLRAD
STLEKLAALKPAFDKKHGTLTAGNSTPLTDGAAAVLLCSEEWAKANDLPIQAYLTAGRSS
AIDFVHGEGLLMAPTVAVSELLMHTGLTLQDFDSYEIHEAFAAQALCTLKAWEDPDFCRH
KLGRDHAMGAIDRNRMNIKGGSLAFGHPFAATGARVLGNMAAILEERGNGRGLISVCTAG
GMGVAAIVERP
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
gtgtataactcagagaatcacagtaacacgcttcgcaaagtcgtcattgccggcggcgta
cgcatccccttctgccgatcaaattctgtgtatgctgagctgagcaatctggatatgctg
gcggacactctgcagatgttaagcacccgattctcactggctggcaaaaaaatcgatgaa
gtggtggctggcgcagtcacatcgcacagtaaagactggaacctggcccgcgaggccctg
ctgagcacagaactttcccccgctacgccaggtatcacacttcagatggcatgcggtaca
tccttgcaggcagcattgatgtcagccgctaaaattgctaccggacaaatcgattgtgct
attgccgccggcactgataccaccagcgatgcgcctattgtcttcaagcgccgattcgcc
catcgattattaaaagtcagccaggcccgcaacatgaaagccaggctggcggctctgaaa
ggattcaggctgtctgagcttgctcctcaagccccggctaatggcgaaccacgcaccggc
ctggcaatgggtgaacactgtgaactcatggcccacgagtggggggtcacccgtcaggag
caggatcaactggccctggaaagtcacctgaaagccgcagcggcttacgatgccggtttt
tttgatgacatggtgcaaatgtacgaaggggtagcccgcgacaataatctgcgcgctgac
agcacattggaaaaactggcagcactcaagccagccttcgacaaaaaacatggcacttta
accgccggcaacagcacaccgctgactgacggcgccgcagccgttctgctgtgcagtgag
gagtgggccaaggctaacgacctgcccatccaggcttacctgaccgccgggcgcagcagc
gccatcgattttgtgcatggcgaaggcctgctgatggcgccgaccgttgccgtcagcgag
ctgttgatgcacacaggtctgacattgcaggatttcgatagctacgaaattcacgaggca
tttgccgcacaggctttatgcaccctgaaggcctgggaagaccctgacttttgtcgccac
aaactcggccgcgaccatgccatgggtgccatcgatagaaacaggatgaatatcaaaggc
ggatcattggcctttggccacccgtttgccgccaccggcgcccgcgtgcttggcaacatg
gctgccattctggaggaacgtggcaacggtcgcggcctgatttccgtgtgcacggcaggc
ggcatgggcgttgccgccatcgtcgagcgcccctga

DBGET integrated database retrieval system