KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_0252Help
Entry
PSTAA_0252        CDS       T01976                                 

Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PSTAA_0252
   00330 Arginine and proline metabolism
    PSTAA_0252
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    PSTAA_0252
Enzymes [BR:psr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     PSTAA_0252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
282050..282958
Genome map
AA seq 302 aa AA seqDB search
MHALLQEILDEVRPLLGQGRVASYIPALADVAPDQLGIAVCSADGELFHAGDAQTPFSIQ
SISKVFSLVQAIGHRGESLWERLGHEPSGQPFNSLVQLEFERGRPRNPFINAGALVICDV
NQSRFATPELSMRDFVRHLSGNPLVISDTRVAESEYQHRARNAAMAYLMQSFGNFHNDVE
AVLRSYFHHCALRMSCVDLARAFGFLARDGVCPQGGEAVLTPRQAKQVNAIMATSGLYDE
AGNFAYRVGLPGKSGVGGGIVAVVPGRFTVCVWSPELNAAGNSLIGMAALEALSQRIGWS
VF
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcgctgttgcaggagattctcgacgaggtgcgcccgctgctcgggcagggccgt
gtggccagctacatcccggccttggccgacgtggcgccggatcagctgggcatcgccgtg
tgcagcgccgacggcgagctgttccacgccggcgacgcgcagacgccgttttcgatccag
agcatttccaaggtgttcagcctggtgcaggccatcggccatcgcggcgagtcgctatgg
gagcgcctcggccacgaaccctccgggcaaccgttcaattcgctggtgcagctggaattc
gaacgcggccggccgcgcaatccgttcatcaacgccggcgcgctggtgatctgcgacgtc
aaccagtcgcgcttcgccacgcccgaactgtcgatgcgcgacttcgtccggcacctgtcc
ggcaacccgctggtcatctccgacacccgggtggccgagtccgagtaccagcaccgcgca
cgcaatgccgccatggcctacctgatgcagtcgttcggcaacttccacaacgacgtcgag
gcggtactgcgcagctacttccaccactgcgcgctgcgtatgagctgcgtcgatctggcc
cgtgcgttcggcttcctcgcccgcgacggcgtctgcccgcagggcggcgaggccgtgctc
acgccgcgccaggccaagcaggtcaacgccatcatggccaccagcggcctctacgacgag
gccggcaacttcgcctaccgggtcgggctgcccggcaagagcggtgtcggcggcggcatc
gtcgcggtggtgccggggcgcttcaccgtctgcgtctggtcgcccgaactgaacgccgcc
ggcaactcgctgatcggcatggccgcgctggaggcgctgtcgcagcgcattggctggtcc
gtattctga

DBGET integrated database retrieval system