KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_0252Help
Entry
PSTAA_0252        CDS       T01976                                 

Definition
(GenBank) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
psr00220  Arginine biosynthesis
psr00250  Alanine, aspartate and glutamate metabolism
psr00471  D-Glutamine and D-glutamate metabolism
psr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PSTAA_0252
   00220 Arginine biosynthesis
    PSTAA_0252
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    PSTAA_0252
Enzymes [BR:psr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     PSTAA_0252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase GAF
Motif
Other DBs
NCBI-ProteinID: AEA82173
UniProt: F2MXP5
Position
282050..282958
Genome map
AA seq 302 aa AA seqDB search
MHALLQEILDEVRPLLGQGRVASYIPALADVAPDQLGIAVCSADGELFHAGDAQTPFSIQ
SISKVFSLVQAIGHRGESLWERLGHEPSGQPFNSLVQLEFERGRPRNPFINAGALVICDV
NQSRFATPELSMRDFVRHLSGNPLVISDTRVAESEYQHRARNAAMAYLMQSFGNFHNDVE
AVLRSYFHHCALRMSCVDLARAFGFLARDGVCPQGGEAVLTPRQAKQVNAIMATSGLYDE
AGNFAYRVGLPGKSGVGGGIVAVVPGRFTVCVWSPELNAAGNSLIGMAALEALSQRIGWS
VF
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcgctgttgcaggagattctcgacgaggtgcgcccgctgctcgggcagggccgt
gtggccagctacatcccggccttggccgacgtggcgccggatcagctgggcatcgccgtg
tgcagcgccgacggcgagctgttccacgccggcgacgcgcagacgccgttttcgatccag
agcatttccaaggtgttcagcctggtgcaggccatcggccatcgcggcgagtcgctatgg
gagcgcctcggccacgaaccctccgggcaaccgttcaattcgctggtgcagctggaattc
gaacgcggccggccgcgcaatccgttcatcaacgccggcgcgctggtgatctgcgacgtc
aaccagtcgcgcttcgccacgcccgaactgtcgatgcgcgacttcgtccggcacctgtcc
ggcaacccgctggtcatctccgacacccgggtggccgagtccgagtaccagcaccgcgca
cgcaatgccgccatggcctacctgatgcagtcgttcggcaacttccacaacgacgtcgag
gcggtactgcgcagctacttccaccactgcgcgctgcgtatgagctgcgtcgatctggcc
cgtgcgttcggcttcctcgcccgcgacggcgtctgcccgcagggcggcgaggccgtgctc
acgccgcgccaggccaagcaggtcaacgccatcatggccaccagcggcctctacgacgag
gccggcaacttcgcctaccgggtcgggctgcccggcaagagcggtgtcggcggcggcatc
gtcgcggtggtgccggggcgcttcaccgtctgcgtctggtcgcccgaactgaacgccgcc
ggcaactcgctgatcggcatggccgcgctggaggcgctgtcgcagcgcattggctggtcc
gtattctga

DBGET integrated database retrieval system