KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_0523Help
Entry
PSTAA_0523        CDS       T01976                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
psr00010  Glycolysis / Gluconeogenesis
psr00030  Pentose phosphate pathway
psr00051  Fructose and mannose metabolism
psr00052  Galactose metabolism
psr00230  Purine metabolism
psr00500  Starch and sucrose metabolism
psr00520  Amino sugar and nucleotide sugar metabolism
psr00521  Streptomycin biosynthesis
psr01100  Metabolic pathways
psr01110  Biosynthesis of secondary metabolites
psr01120  Microbial metabolism in diverse environments
psr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:psr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSTAA_0523
   00030 Pentose phosphate pathway
    PSTAA_0523
   00051 Fructose and mannose metabolism
    PSTAA_0523
   00052 Galactose metabolism
    PSTAA_0523
   00500 Starch and sucrose metabolism
    PSTAA_0523
   00520 Amino sugar and nucleotide sugar metabolism
    PSTAA_0523
  Nucleotide metabolism
   00230 Purine metabolism
    PSTAA_0523
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PSTAA_0523
Enzymes [BR:psr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PSTAA_0523
    5.4.2.8  phosphomannomutase
     PSTAA_0523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV Ost5 IncA
Motif
Other DBs
NCBI-ProteinID: AEA82443
UniProt: F2MWM6
Position
complement(574601..577171)
Genome map
AA seq 856 aa AA seqDB search
MALFKRTAKDSGVLNPAETRSKRSGINIKPLLGGLASSLIGLGAAAALLWLGLQNAEQEQ
RTQLASAWGQSQASALQQALRQLQGDTQAVTERLMLVEALRGDGERRRDAEQRLLDLPGV
VDAHLNVRGRAVPDTSRPGPLNFAALDLLQRAEAGHAPAPEAYKVDNRWLLYSAVALRGE
GQQAIRGTLLLVTDLERLFAGLPTLPAGAGQLRLSQQFAGAPEQVLLQRGTPGNATALTL
PSGNSNWTLSYVPGSEAAPAMLTPLHLIAAALLALAGVLIGLQLVLGSQQRKLREDVLRI
SRLLQELSTGKTIQIPALSLPVLDALARNMVRLPVRPAGSAPTQAPAAAPAVRPAKPTEY
VAPPLPETDILDIDILDEDQDIFGLDTKERETAMSSAKAPNLPASIFRAYDIRGVVGDSL
TTETAYWVGRAIGSESLAKGEPNVSVGRDGRLSGPELVQHLIQGLLDSGCDVSDIGMVPT
PVLYYAANILAGKSGVMLTGSHNPPDYNGFKIVIAGDTLANEQIQVLRKRIETNDLSSGV
GKVEQVDVLERYFEQIRSDIAMAKPMKVVVDCGNGVAGVIAPKLIEALGCTVIPLYCEVD
GNFPNHHPDPGKPENLVDLIAKVKSEKADLGLAFDGDGDRVGVVTNAGTMIYPDRLLMLF
AKDVVSRNPGADIIFDVKCTRRLTPLISGYGGRPVMWKTGHSLIKKKMKESGALLAGEMS
GHIFFKERWFGFDDGIYSAARLLEILSQDKRDAEQVFAAFPCDISTPEINITVTEESKFT
IMDALQRDAKWGEANLITLDGVRVDYPKGWGLIRASNTTPVLVLRFEADSEEELSRIQDV
FRGQLLSVAPDLKLPF
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atggcactcttcaagcgcaccgccaaggattcaggcgtactgaacccggccgagacccgc
agcaagcgcagcggcatcaacatcaaacccttgctcggcggcctggcgagcagcctgatc
ggcctcggcgcagcggcagcgctgctctggctgggcctgcagaatgccgagcaggagcaa
cggacgcagctggccagcgcctggggccagagccaggccagcgcgctgcagcaagcgctg
cgtcagctgcagggcgatacccaggcggtgacggagcgactgatgctggtcgaagcgctg
cgcggcgacggcgaacgtcgacgcgatgccgagcagcgcctgctggacctgcccggcgta
gtcgacgcgcatctgaatgtccgcggccgcgccgtacccgacaccagccgcccgggaccg
ctgaacttcgccgcgctcgatctgctgcagcgtgcggaagccggccacgcgcccgccccc
gaagcgtacaaggtcgacaaccgctggctgctgtacagcgccgtcgccctgcgcggcgaa
ggtcagcaggcgattcgcggcacgctgctgctggtgactgacctcgaacgcctcttcgcc
ggcctcccgacgctgcccgccggcgccgggcaactgcggttgagccagcagttcgccggc
gcaccggagcaagtgctgctgcagcgcggcaccccaggcaatgccacagccctgacactg
cccagcggcaattccaactggacgctgagctacgttccgggcagcgaagccgcgccggcc
atgctgacgcccctgcacctgatcgccgcggcgctgctggcactggccggcgtactgatc
ggcctgcaactggtgctcggcagccagcaacgcaagctgcgcgaagacgtcctgcggatc
agtcgcctgctgcaggaactctccacgggcaagaccatccaaataccggccttgagcctg
ccggtcctcgacgcactggccaggaacatggtccgactgcccgtccgccccgccggatcg
gctccgactcaggcacctgccgcggcccccgccgtacggcccgccaaacctaccgagtac
gtcgctccgcccctgccggagaccgatattctcgacatcgacattctcgacgaggaccag
gacatcttcggcctcgacaccaaggagcgagaaaccgcaatgagcagcgccaaagccccg
aacttgcccgccagtatcttccgcgcctacgacatccgtggcgttgtcggcgacagcctg
accaccgaaaccgcgtactgggtcggccgcgccatcgggtccgagagcctcgccaaaggt
gaacccaacgtctccgtcggccgcgacggtcgcctgtccggcccggagctggtccagcac
ctgatccagggcctgctcgacagcggctgcgacgtcagcgacatcggcatggtgccgacg
ccggtgctctactacgcggccaacatcctcgccggcaagtccggggtgatgctcaccggt
agccacaacccgccggactacaacggcttcaagatcgtcatcgccggagacaccctggcc
aacgagcagatccaggtgctgcgcaagcggatcgagaccaacgacctgtccagcggcgtc
ggcaaggtcgaacaggtcgatgtactggagcgttacttcgagcagatccgcagcgacatc
gccatggccaagccgatgaaggtggtggtcgactgcggcaacggtgtggccggcgtcatc
gcgcccaagctgatcgaggccctgggctgcacggtgatcccgctgtactgcgaggtcgac
ggcaacttccccaatcaccaccccgatcccggcaagccggaaaacctggtcgacctgatc
gccaaggtgaaatccgagaaggctgatctgggcctggccttcgacggcgacggcgatcgc
gtcggcgtggtaaccaacgccggcaccatgatctacccggaccgcctgctgatgctgttc
gccaaggacgtggtttcgcgcaatccaggcgccgacatcatcttcgacgtcaaatgcacc
cgccgcctgaccccgctgatcagcggctatggcggccgcccggtgatgtggaagaccggc
cactcgctgatcaagaagaagatgaaggaatccggcgcgctgctggccggcgagatgagc
ggccacattttcttcaaggaacgctggttcggcttcgacgacggcatctacagtgctgca
cgcctgctggagatcctcagtcaggacaagcgtgacgccgaacaggtgtttgccgccttc
ccctgcgatatctcgacgccggagatcaacatcacggtgacagaggaaagcaaattcacc
atcatggacgccctgcaacgcgacgccaaatggggcgaagccaacctgatcaccctcgac
ggtgtgcgggtcgactatcccaagggctggggcctgatccgcgcctccaacaccaccccg
gtgctggtactgcgcttcgaggccgacagcgaagaagagctcagccgcatccaggacgtc
ttccgcggccagctgctcagcgttgcacccgacctcaaactgccgttctga

DBGET integrated database retrieval system