KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_0579Help
Entry
PSTAA_0579        CDS       T01976                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
psr00860  Porphyrin and chlorophyll metabolism
psr01100  Metabolic pathways
psr01110  Biosynthesis of secondary metabolites
psr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PSTAA_0579 (hemD)
Enzymes [BR:psr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PSTAA_0579 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AEA82499
UniProt: F2MXY1
Position
633334..634104
Genome map
AA seq 256 aa AA seqDB search
MTGWRLLLTRPAEECEALAATLAEAGVHSSSLPLLAIEPLPESAEQRATILELDRYCAVV
VVSKPAARLGLELLDSYWPQPPFGQAWFSVGGATGAILEAYGLDVSWPERGDDSEALLAL
PRLAQALARPDPKVLIMRGEGGREFLAETLRGRGVQVDFLELYRRSLPDYPPGTLVQVVR
SERLNGLVVSSGQGLLSLHELAADTWRELCELPLFVPSPRVAEMARQLGAKRIVDCRGAG
AAALLAALRETAVAAS
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggctggcgcctgctgctgacccggccggccgaggaatgcgaggcattggccgcg
actctcgccgaggctggtgtgcacagctccagcctgccgctgctggcgatcgagccgctg
ccggagtccgccgagcagcgtgcaacgatcctcgagctggatcgctattgcgccgtcgtc
gtggtcagcaagccggccgcccgcctgggcctggaactgctcgatagctactggccgcag
cccccgttcggtcaggcctggttcagcgtcggtggcgccaccggggcgatcctcgaagcc
tacgggctggacgtcagctggcccgagcggggtgacgacagtgaagcgctgctggcgctg
ccacgattggcgcaggcgctggccaggcccgatccaaaggtattgatcatgcgcggcgag
ggcggccgcgagttcctcgccgagacgcttcgcgggcgtggcgtgcaggtcgactttctc
gagctgtaccgccgcagcctgcccgactatccgcctggaacgctggtgcaggtcgttcgg
tcggaacggctcaacggcctggtggtcagcagtgggcagggtctgctgtcgctgcatgag
ctggcagccgatacctggcgcgaattgtgtgagctacccttgttcgtacccagtccgcgg
gtggcggagatggctcgacagctgggcgccaaacgaattgtggattgccgtggcgcagga
gctgcggccttgctggcggccttgcgggaaaccgcggtggccgcttcctga

DBGET integrated database retrieval system