KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_0656Help
Entry
PSTAA_0656        CDS       T01976                                 

Gene name
folK-1
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:psr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PSTAA_0656 (folK-1)
Enzymes [BR:psr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     PSTAA_0656 (folK-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
733475..734017
Genome map
AA seq 180 aa AA seqDB search
MSLTPVLLGLGSNVQREPHLHAGLDALAELLVSMRCSPVFESLAVGYKGDNFYNLVVAGD
TELPLTELDRRLKFIEADNGRYAPDRKGLPLDIDVLLYGELVGNFHGLLLPRAEILKNAF
VLWPLALLAPTVRHPAADASFAELWAQSTIDQQLWPVPFQWRGAELTPPELVRAHPPRCA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctaactccggtgctgctcggcctgggcagcaatgtccagcgtgagccccatctg
catgccggcctcgatgcgctggccgagctgctggtgagcatgcgttgttcgccggtgttc
gaaagcctggcggtgggctacaagggcgacaacttctacaacctcgtggtcgccggcgat
accgagctgccgctgaccgaactggaccggcggctcaagttcatcgaggcggacaacggg
cgttacgcgccggatcgcaagggattgccactggatatcgacgtgctgctctatggcgag
ctggtcggcaatttccacggtttgctgctgccgcgtgcggagattctcaagaacgccttc
gtgctctggccgctggcgctgctggccccgaccgtacggcatcccgccgcggatgccagc
tttgccgagctgtgggcgcaatcgaccatcgaccaacagctctggccggtgcccttccag
tggcgcggcgcggagctcacgcccccggagctggtccgcgcccacccgccgcgttgtgcc
tga

DBGET integrated database retrieval system