KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_0680Help
Entry
PSTAA_0680        CDS       T01976                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K14268  5-aminovalerate/4-aminobutyrate aminotransferase [EC:2.6.1.48 2.6.1.19]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
psr00250  Alanine, aspartate and glutamate metabolism
psr00310  Lysine degradation
psr00650  Butanoate metabolism
psr01100  Metabolic pathways
psr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psr00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    PSTAA_0680 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PSTAA_0680 (gabT)
   00310 Lysine degradation
    PSTAA_0680 (gabT)
Enzymes [BR:psr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     PSTAA_0680 (gabT)
    2.6.1.48  5-aminovalerate transaminase
     PSTAA_0680 (gabT)
Amino acid related enzymes [BR:psr01007]
 Aminotransferase (transaminase)
  Class III
   PSTAA_0680 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AEA82599
UniProt: F2MZK9
Position
760948..762228
Genome map
AA seq 426 aa AA seqDB search
MSKTNESLMQRRVAAVPRGVGQIHPIFADHAKNSSVVDVEGREFIDFAGGIAVLNTGHLH
PKIVKAVEDQLHKLTHTCFQVLAYEPYVELCEKINARVPGDFAKKTLLVTTGSEAVENAV
KIARAATGRAGVIAFTGAYHGRTMMTLGLTGKVAPYSAGMGLMPGGIFRAQYPCAIHGVS
VDDSIASIERIFKNDAEPRDIAAIIVEPVQGEGGFNVAPKDFMARLRALCDEHGILLIAD
EVQTGAGRTGTFFAMEQMGVVADLTTFAKSVGGGFPIAGVCGEAEIMDAIAPGGLGGTYA
GNPLSCAAALAVMEIFEEEHLLDRCKAVAEKLTTGLKAIQAKHKEIGEVRGLGAMIAIEL
FEDGDLARPAAALTSQIVARAREKGLILLSCGTYYNVLRVLVPLTVEDELLERGLAILGE
CFDELT
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaccaacgaatccctgatgcaacgccgtgtcgccgccgttccccgtggcgtc
ggccagatccacccgatctttgccgaccacgcgaagaacagcagcgtggtggatgtggag
ggccgcgagttcatcgatttcgccggcggcatcgccgtgctgaataccggccacctgcac
ccgaagatcgtcaaggcggtggaagaccagctgcacaagctcacccacacctgcttccag
gtgctggcctacgagccgtacgtcgagctgtgcgagaagatcaacgcccgggtgccgggt
gatttcgccaagaagactctgctggtcaccaccggctccgaggccgtggagaacgcggtg
aagatcgcccgcgccgccaccggccgtgccggcgtgattgccttcaccggcgcctatcac
ggccgcaccatgatgaccctcggcctgaccggcaaggtcgccccgtactccgccggcatg
ggcctgatgcccggcgggatcttccgtgcgcagtatccctgcgcgatccatggtgtcagc
gtcgatgactcgatcgcgagcatcgagcgcatcttcaagaacgatgccgagccgcgcgac
atcgccgcgatcatcgtcgaaccggtgcagggcgagggcggcttcaatgtcgcgccgaag
gatttcatggcccgcctgcgcgcgctctgcgacgagcacggcatcctgctgatcgccgac
gaggtgcagaccggcgccggacgcaccggcaccttcttcgccatggagcagatgggcgtg
gtcgccgacctgaccaccttcgccaagtcggtcggcggcggcttcccgatcgccggcgtg
tgcggcgaggccgagatcatggatgccatcgcacccggcgggctgggcggcacctatgcc
ggcaacccgttgtcctgcgcggcggcgctggcggtcatggaaatcttcgaggaggagcat
ctgctcgaccgctgcaaggccgtggcggagaagctcaccaccggcctcaaggcgatccag
gccaagcacaaggagatcggcgaggtgcgcggcctcggcgcgatgatcgccatcgagctg
ttcgaggatggcgacctggcgcgaccggccgcggcgctcacgtcgcagatcgtcgcccgg
gcgcgggagaagggcttgatcctgctgtcctgcggtacctactacaacgtgctgcgcgtg
ctggtgccgctgaccgtcgaggacgagctgctcgagcgcggcctggccatcctcggcgag
tgtttcgacgagctgacctga

DBGET integrated database retrieval system