KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_0825Help
Entry
PSTAA_0825        CDS       T01976                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
psr00010  Glycolysis / Gluconeogenesis
psr00071  Fatty acid degradation
psr00350  Tyrosine metabolism
psr00625  Chloroalkane and chloroalkene degradation
psr00626  Naphthalene degradation
psr01100  Metabolic pathways
psr01110  Biosynthesis of secondary metabolites
psr01120  Microbial metabolism in diverse environments
psr01130  Biosynthesis of antibiotics
psr01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:psr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSTAA_0825
  Lipid metabolism
   00071 Fatty acid degradation
    PSTAA_0825
  Amino acid metabolism
   00350 Tyrosine metabolism
    PSTAA_0825
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PSTAA_0825
   00626 Naphthalene degradation
    PSTAA_0825
Enzymes [BR:psr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PSTAA_0825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C TrkA_N 2-Hacid_dh_C Urocanase Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: AEA82735
UniProt: F2MWU0
Position
896502..897524
Genome map
AA seq 340 aa AA seqDB search
MTQTMKAAVVHAFGEPLRLEEVKVPMPGPGQILVKIAASGVCHTDLHAAEGDWPVKPSLP
FIPGHEGVGHVAAVGAGVTRVKEGDRVGVPWLYTACGCCEHCLTGWETLCEGQQNTGYSV
NGGYAEYVLADPNYVGILPKNVEFDEIAPILCAGVTVYKGLKVTGARPGQWVVISGIGGL
GHVAVQYAKAMGLHVVAVDVDDAKLELAKRLGAKLTINARTENPVEVVQRDIGGAHGVLV
TAVSNSAFGQAIGMARRHGTVALVGLPPGDFPTPIFDVVLKAISITGSIVGTRADLQEAL
DFAGEGLVKATIHTDSLDNINQIFDDMRAGRIEGRIVMKM
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaccatgaaagcggcagtggttcacgcctttggcgagccgctgcgcctcgag
gaagtcaaggtgccgatgcccggccccggtcagatcctggtgaagatcgccgcctccggc
gtctgccacaccgacctgcacgctgccgagggcgactggccggtgaaaccgtccctgccg
ttcattcccggccatgaaggcgttggccacgtcgcggcggtgggtgccggcgtgacccgg
gtgaaggagggcgatcgcgtcggcgtgccctggctgtacaccgcctgcggctgctgcgag
cactgcctgactggctgggaaaccctctgcgaaggccagcagaacaccggctactcggtc
aatggcggctacgccgaatacgtgctggccgacccgaactacgttggcatcctgccgaag
aacgtcgagttcgacgagatcgcgccgattctctgcgccggtgtcactgtctacaagggc
ctcaaggtcaccggtgcacgccccggccagtgggtggtgatctccggcatcggcggcctc
ggtcatgtcgcggtgcagtacgccaaggcgatggggctgcacgtggtggcggtggatgtg
gatgacgccaagctggagctggccaagcgtctgggtgccaagctgaccatcaacgcacgc
acggagaatcccgtggaggtggtccagcgcgatatcggcggcgcccacggcgtgctggtc
accgcggtgtccaacagcgccttcggccaggccattggcatggcgcggcggcatggcacc
gtggcgctggtcgggctgccgccgggagacttcccgacgccgatcttcgacgtcgtgctc
aaggccatcagcatcaccggctcgatcgtcggcacccgcgccgatctgcaggaggcgctg
gatttcgccggcgagggcctggtcaaggcgaccatccacaccgacagcctggacaacatc
aaccagatcttcgacgacatgcgcgccgggcgcatcgaaggccgtatcgtgatgaagatg
tag

DBGET integrated database retrieval system