KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_0909Help
Entry
PSTAA_0909        CDS       T01976                                 

Gene name
ccpR
Definition
cytochrome c551 peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
psr  Pseudomonas stutzeri DSM 4166
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(989846..990874)
Genome map
AA seq 342 aa AA seqDB search
MRPSLPLLLSSLLVTGAASADDLRERANAIFKPIPDKVTEVRGQKVSEDQAMLGHKLWFD
PRLSSSHVISCNTCHNLSIGGSDNVPTSIGHGWQKGPRNSPTVLNAVFNAAQFWDGRAKD
LQEQAKGPVQASVEMNSTPERVVATLKSIPEYAAEFKKAFPKDKDPVSFDNMAYALEAFE
VSLTTPNSPFDRFLKGEDKALDDKQKQGLALFMDAGCSACHNGVNLGGQGYFPFGVVKKP
GAEVLPAGDKGRFTVTNTASDEYVFRAAPLRNVALTPPYFHSGEVWELEQAVAIMGDSQL
GRQLNQDEVSAITAFLRSVTGDQPQVAYPVLPASTADTPKPQ
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccttctcttcccctattgcttagcagcctattggtcaccggcgccgcgagcgct
gacgatcttcgcgaacgcgccaatgccatcttcaagccgattccggacaaggtcaccgag
gtgcgtggccagaaggtcagcgaggatcaggccatgctcgggcacaagctgtggttcgac
ccgcgcctgtccagcagccacgtgatcagctgcaacacctgccacaacctgagcatcggc
ggcagcgacaacgtgccgacgtccatcggccatggctggcagaaaggcccgcgcaactcg
cccactgtgctgaatgccgtgttcaacgccgcccagttctgggatggccgcgccaaggat
ctccaggaacaggccaagggcccggtccaggcgagcgtggaaatgaacagcacgcccgaa
cgcgtcgtcgccacgctcaagagcattccggagtacgccgcggagttcaagaaggccttc
ccgaaagacaaggacccggtcagcttcgacaacatggcctatgcgctggaagccttcgaa
gtcagcctgaccacgccgaactcaccgttcgaccgcttcctcaagggcgaggacaaggcc
ctggatgacaagcagaagcaaggcctcgcgctgttcatggacgcgggctgttccgcctgc
cacaacggcgtgaacctcggcggccagggctacttcccgttcggcgtcgtcaagaagccg
ggtgccgaagtgctgccggccggcgacaagggccgcttcacagtgaccaacaccgccagc
gacgaatacgtcttccgcgccgcgccgctgcgcaacgtcgccctgacgccgccgtacttc
cacagcggcgaggtctgggaactggaacaggcggtggccatcatgggcgacagccagctg
ggccgtcagctcaatcaggacgaggtcagcgccatcaccgccttcctgcgcagcgtgacc
ggcgatcagcctcaggtagcctacccggttcttccggcgagcaccgccgacacaccgaaa
ccgcagtaa

DBGET integrated database retrieval system