KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_1158Help
Entry
PSTAA_1158        CDS       T01976                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
psr  Pseudomonas stutzeri DSM 4166
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1242918..1243646
Genome map
AA seq 242 aa AA seqDB search
MGVIRMFAAATIGLVSTVAMAADPDQAIRQSLQKIQPDMPIEAVAESPMPGVYQVQLEGG
RQLYASADGQFVIQGYLYQFKDGQAVNLTEQAQSRSVAKQINAIPASEMVVFAPKAPKTH
ITVFTDTDCGYCQKLHSEVPQLNRLGVEVRYVAFPRQGMGSHGANTLTSVWCAKDRQDAM
NKAKAREELPAASCDTPIAKQYQLGQMIGVQGTPAIILANGQMIPGYQPAAQLAEVALAA
AK
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtgattcgtatgtttgctgccgccacaattggtctggtcagcaccgttgcaatg
gccgccgatccggatcaggcaatacgtcaatcgctgcagaaaattcagcccgacatgccg
atcgaggcggtagccgagagcccgatgccgggggtgtatcaggttcagctggaaggcggg
cggcagctgtatgccagtgccgacggtcagtttgtcattcagggttatctctaccagttc
aaggatgggcaggcggtcaacctgaccgagcaggcacagagccgatcggtggccaagcag
atcaacgccattccggcgagtgagatggtggtgttcgcacccaaggcgccgaaaacccat
atcaccgtgttcaccgataccgattgtggctattgccagaagctgcacagcgaagtgcct
cagctcaaccgtctcggtgtggaggtgcgctatgtggcgttcccgcgccaggggatgggc
agccacggtgccaataccctgaccagtgtgtggtgcgccaaggaccgtcaggatgccatg
aacaaggccaaggctcgtgaagaactgccggcagccagttgcgataccccgatcgccaag
caataccagttggggcagatgatcggtgtgcagggtacgccggccatcattctcgccaac
ggtcaaatgatccccggctaccagccagcggcgcagcttgcagaggtggcgctcgctgcg
gccaagtaa

DBGET integrated database retrieval system