KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_1161Help
Entry
PSTAA_1161        CDS       T01976                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:psr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PSTAA_1161 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSTAA_1161 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PSTAA_1161 (thrC)
Enzymes [BR:psr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PSTAA_1161 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1245716..1247125
Genome map
AA seq 469 aa AA seqDB search
MRYISTRGQAPALNFEDVLLAGLASDGGLYVPENLPRFTVEEIASWAGLPYHELAFRVMR
PFVAGSIPDADFKKILEETYGVFAHGAIAPLRQLNGNEWVLELFHGPTLAFKDFALQLLG
RLLDYVLAKRGERVVIMGATSGDTGSAAIEGCRRCENVDIFILHPHQRVSEVQRRQMTTI
LGDNIHNIAIEGNFDDCQEMVKASFADQGFLKGTRLVAVNSINWARIMAQIVYYFHAALQ
LGGPARSVAFSVPTGNFGDIFAGYLARNMGLPINQLIVATNRNDILHRFMSGNHYDKDTL
HPSLSPSMDIMVSSNFERLLFDLHGRNGKAVADLLDGFRASGRLSVEEDRWTEARRLFDS
LAVDDEQTCATIARVFKETGEVLDPHTAIGVHAARECRRSLSIPMVTLGTAHPVKFPDAV
EKAGIGQALALPAHLADLFERSERCTVLPNELKAVQAFVGQHGNRGKPL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcgctacatcagcacccgcggccaggcaccggccctgaatttcgaagatgtgctgctg
gccggtctggccagcgacggcggcctctacgtgccggagaacctgccgcgcttcactgta
gaggaaatcgcttcctgggccggcctgccgtatcacgaactggcgttccgggtcatgcga
ccattcgttgccggcagcattccggatgccgacttcaagaaaatcctggaagagacctat
ggcgttttcgcccatggcgccattgccccgctgcgccagctgaacggcaacgagtgggtg
ctcgagctgttccacggtccgaccttggccttcaaggatttcgccctgcagctgctcggc
cgtctgctcgactacgtgctggccaagcgtggcgagcgcgtggtgatcatgggagccacc
tccggtgacaccggttcggctgccatcgaaggctgccgccgttgcgagaacgtcgatatc
ttcatcctgcacccgcaccagcgcgtgtcggaagtgcagcgccggcagatgaccaccatc
ctcggcgacaacattcacaacatcgccatcgaaggcaatttcgatgactgccaggagatg
gtcaaggccagcttcgccgaccaggggttcctcaagggcacccgcctggtggcagtcaac
tcgatcaactgggcgcggatcatggcccagatcgtctactacttccatgccgcactgcag
ctgggcggcccggcgcgttcggtcgccttctcggtcccgaccggcaatttcggtgacatc
ttcgccggttacctggcgcgcaacatggggctgccgatcaatcagctgatcgttgccacc
aaccgcaacgacatcctgcaccgtttcatgtccggcaatcactacgacaaggacacgctg
catccgtcgctgtcgccgtccatggacatcatggtgtcgtcgaacttcgaacgcctgctg
ttcgacctgcacggtcgcaacggcaaggccgtagccgatctgctggatggcttccgcgcc
agcggcagactctcggtggaagaggatcgctggaccgaagcgcgtcgactcttcgattcg
ctggcggtggacgacgagcagacctgcgcgaccatcgcccgggtgttcaaggagaccggt
gaggtgctcgatccgcataccgccatcggcgtgcacgccgcccgtgaatgccgtcgcagc
ctgagcatcccgatggtcaccctgggcaccgcgcatccggtgaaattcccggatgcggtg
gagaaggccggtatcggtcaggcgctggcgctgccggcgcatcttgccgacctgttcgag
cgtagcgagcggtgcacggtgttgccaaacgagctcaaggcggtgcaggccttcgtcggc
cagcacggcaatcgcggcaagccgctctaa

DBGET integrated database retrieval system