KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_1482Help
Entry
PSTAA_1482        CDS       T01976                                 

Definition
hypothetical protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:psr00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1552684..1554762
Genome map
AA seq 692 aa AA seqDB search
MSTNLFTGARKALVASIAMAALMGGVTVATVPYAAAATTVAAASVSTKVNAFTNTDWLNG
VWRTGAGFSIPATAANQAAFKAGASVRLADGQVRTISRAQVVGSNMSVFLDGAKLDGNKV
GAPQSVATVAAATSAPATAAPAVTAPSTATAYSTSINAFTNTDWLNGVWRKSPGFSIPAN
DGNKANFKVGASVKLADGQVRKITQAQVVGSNMSVFLEGAAVNGSVVGAPNKLTLAGTTA
TAPAPTAPSSSVVATSNLNSFTNNEWLNGVFRASAGFSIQATSANVAAFKTGASVKLADG
QVRKVLRTQVVGSNLSVFLEGAAINGAAVGYPKTVSVVSTSATPSAPSVTTPPAAVAPAP
SPAPSAPSTTNGKPLLVGVNLSGAGFGPSVVPGTHGTNYTYPAESYYKKYADLGMPLVRL
PFLWERIQPKLNTPLNATELARLKQSLDFAQKHNVKVILDLHNYYRYFNKLIGSNEVPIS
SFAAVWKQIAQEVVNHPAVEGYGLMNEPYSTNGLWPQAALAAAQAIRTVDSKRWIYVAGD
RWSSAFHWPHYNTQLISNPWMRDPKNNLVYEAHMYIDKDFSGNYFDKNEKFDPMIGVNRV
KPFVDWLKQNKLRGYIGEHGIPDFSPSALVATDNLLSYLRQNCIPSTYWAAGPWWGEYAL
SLDVTSGKHRPQLPILQKHAKTAHSCTSIGPL
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccaacctgtttaccggtgcccgtaaggcactcgtcgcttccatcgccatggct
gccctcatgggtggcgtaaccgtagcaactgttccttacgctgctgcagctaccactgtc
gctgcagcctccgtttccaccaaggtcaacgccttcaccaataccgactggcttaatggt
gtctggcgcactggcgcaggcttctccattccggccacggctgccaaccaggcggctttc
aaggcgggcgcctcggttcgcctggcggacggccaagtgcgcaccatcagccgcgcgcag
gtcgtcggcagcaatatgagtgtgttccttgatggcgccaaactcgatggcaacaaggtg
ggtgcaccgcagtcggtcgcaaccgtggctgccgcaacttcggctcccgctaccgcggcg
cctgcagtaaccgcgccgtcgacggcgactgcttactccaccagcattaatgcctttacc
aacaccgattggctcaatggtgtctggcgcaagtcgccgggcttctccattccggccaac
gatggcaataaggccaacttcaaagtcggtgcttcggtaaaactggccgatggccaggtt
cgcaagattacccaggcacaagtcgtcggtagcaacatgagcgtcttcctcgaaggcgcc
gcggttaacggaagtgtagtgggcgcgcccaacaagctgaccctcgccggtactaccgca
actgctccggcaccgaccgcaccttcgtcttcggtcgttgccaccagcaacttgaacagc
ttcaccaacaatgagtggctgaacggtgtgttccgtgcgtccgccgggttctccatccag
gcaaccagcgccaacgtcgccgctttcaagaccggtgcatcggtaaaactggctgacggc
caggtgcgcaaggttctgcgtacccaggtggtcggcagcaacctgagcgtgttcctggaa
ggcgcggccatcaacggcgctgctgtcggttacccgaaaacggtctccgtggtcagcacc
tccgccacgccttcggctccctcggtcaccacgccgcctgctgcggtagcgccggccccg
agcccagcgccgtcagcgccgagcaccaccaatggcaagccgctgctggttggcgtcaac
ctgtccggtgcaggcttcggcccgtcggtggttcccggtacgcacggcaccaactacacc
tatccggccgagtcgtactacaagaagtacgccgacctcggcatgccgctggtacgcctg
ccgttcctctgggagcgtatccagcccaagctgaacacgccgctgaatgccacagaactg
gcgcgcctgaagcagtcgctggatttcgcgcagaagcacaacgtcaaggtgatcctcgac
ctgcacaactactaccgctatttcaacaagctgatcggctcgaacgaagtacccatcagc
tcattcgcggcggtgtggaagcagattgcgcaggaagtggtcaaccacccggcggtggaa
ggttacgggctgatgaacgagccatactccaccaatggtctctggccgcaggccgccctg
gcggctgctcaggcgatccgcaccgtggattccaagcgctggatctacgtggccggtgac
cgctggtccagtgccttccactggccgcactacaacactcagctgatcagcaacccgtgg
atgcgcgatccgaagaacaacctggtgtacgaagcacacatgtacatcgacaaggatttc
tccggtaactacttcgacaagaacgaaaagttcgacccgatgatcggtgtcaatcgcgtc
aagcccttcgtcgactggctgaagcagaacaagctgcgtggctacatcggtgagcacggt
attccggacttctcgccgtccgccctggtggccactgacaacctgctgtcttacctgcgt
cagaactgcatccccagcacttactgggcagcaggtccctggtggggcgagtacgcactg
tcgctggacgtgaccagtggcaagcaccgcccgcagctgccgattctgcagaagcacgcc
aagaccgcgcacagctgcaccagcatcggtccgctgtaa

DBGET integrated database retrieval system