KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_1594Help
Entry
PSTAA_1594        CDS       T01976                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
psr  Pseudomonas stutzeri DSM 4166
Brite
Enzymes [BR:psr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     PSTAA_1594 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1681465..1682100
Genome map
AA seq 211 aa AA seqDB search
MTSQRTRDRLIQRLYEEGLSNAHVLEVIRRTPRHLFVDEALAHRAYEDTALPIGHNQTIS
QPFMVARMSELLLADGPLDKVLEIGTGSGYQTAVLAQLVERVFSVERIQALQDRAKERLV
ELKLRNVVFRWGDGWEGWPALAPYNGIIVTAAAADVPQALLDQLAPGGRLVIPVGAGEVQ
QLMLIIREENGFSRHLLDTVRFVPLLNGPVI
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgcaacgcacacgtgaccgcttgattcagcgactctacgaagaagggctgtcc
aacgcccatgtgctcgaagtgatccgccgtacccctcgtcatctgttcgtcgacgaggca
ctggcgcatcgcgcctacgaggacacggcgctgcccatcggccacaaccagaccatttcg
cagccgttcatggttgcgcgcatgagcgaactgttgctggctgacggcccgctggacaag
gtgctggagatcgggaccggctcgggctatcagaccgccgtgctggcgcagctggtcgag
cgggtgttctccgtcgagcgcatccaggcgctgcaggatcgtgccaaggagcgcctggtc
gaactcaagctgcgcaatgtggtctttcgctggggcgatggttgggagggctggcctgca
ctggcgccttacaacggcatcatcgtcaccgcggcggcagccgatgtgccgcaggccttg
ctcgatcagctggcgcccggtgggcgcctggtgattccggtgggggccggcgaggtccag
caacttatgctgatcattcgagaggaaaacggcttttctcgccatcttctggataccgta
cgtttcgtgccgctgctcaatggacccgtgatttga

DBGET integrated database retrieval system