KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_1737Help
Entry
PSTAA_1737        CDS       T01976                                 

Gene name
acsA
Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:psr01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:psr00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:psr00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:psr00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:psr00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1835809..1837686
Genome map
AA seq 625 aa AA seqDB search
MYQQSVINPEGFWREQAARLDWIRPFSEVKRTSFDDHHVDIKWFADGTLNVSANCLDRHL
AERGDQVAIIWEGDDPSEHREITYRELYQEVCKFANALRGQDVHRGDVVTIYMPMIPEAA
VAMLACARIGAIHSVVFGGFSPEALAGRIIDGSSKVVITADQGIRGGKTIALKENVDEAL
TNPQTRCVQKIIVVRRTGANIRWHPHRDVSYDDLMRVAGEVCAPKEMGAEEPLFILYTSG
STGKPKGVLHTCGGYLLYAALTHERVFDYRPGDIYWCTADIGWITGHSYLIYGPLANGAT
TLMYEGVPNYPDVTRIARIIDKHRVNILYTAPTAIRAMMAEGPAAMEGADGSSLRLLGTV
GEPINPEAWHWYYETVGRSRCPIVDTWWQTETGGILISPLPGATALKPGSATRPLFGVVP
GLVDNLGNLLEGPAEGNLVILDSWPGQMRTIYGDHDRFVDTYFKTFRGMYFTGDGARRDE
DGYYWITGRVDDVLNVSGHRMGTAEIESALVAHAKVAEAAAVGVPHPLKGQAIYVYVTLV
AGTEPSDTLRQELQQWVRHEIGPIAVPDTIQWAPGLPKTRSGKIMRRLLRKIATDDYDTL
GDTSTLADPGVVDQLIEAHEAVKWC
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgtatcagcagtcggtgatcaaccctgaaggattctggcgtgaacaggcggcacggctg
gactggattcggcccttcagcgaggtcaagcgcacctccttcgacgaccatcacgtcgat
atcaagtggtttgccgacggcacgctgaacgtgtcggccaattgcctggaccggcacctg
gccgagcgcggcgatcaggtggcgatcatctgggagggggacgacccctcggagcaccgc
gagatcacctaccgcgagctctaccaggaggtctgcaagttcgccaacgctctgcgtggc
caggatgtgcaccgcggtgacgtggtgaccatctacatgccgatgattcccgaggccgcg
gtggctatgctggcctgcgcgcgcatcggtgcgatccactcggtggtgttcggcggcttc
tcgccggaggcattggccgggcgcatcatcgatggcagctcgaaggtggtgatcactgcc
gatcaaggcatacgtggcggcaagaccatcgccctgaaggagaacgtcgacgaggcgctg
acgaacccgcagacccgttgcgtgcagaagatcatcgtggtgcgccgcaccggagcgaac
atccgctggcacccgcaccgggatgtctcctacgacgacttgatgcgggttgccggcgag
gtctgcgcgccgaaggaaatgggcgccgaggagccgctgttcattctctacacctcgggc
tccaccgggaaacccaagggcgtgctgcacacctgcggcggctacctgctgtacgccgcg
ctgacccacgagcgggtcttcgactaccgccccggcgatatctactggtgcaccgccgac
atcggctggattaccggtcatagctatctgatctacggcccactggccaacggtgcgacg
accctgatgtacgaaggcgtgccgaactatccggacgttacccgtatcgccaggatcatc
gacaagcaccgggtcaacatcctctacaccgcgccgacggcaatccgcgcgatgatggcc
gaggggccggcggcgatggagggtgccgacggttcgagcctgcgcctgctcggcacggtg
ggtgaaccgatcaatccggaagcctggcactggtactacgagacggtcggtcggtcgcgc
tgcccgatcgtcgatacctggtggcagaccgagaccggcggcatcctcatcagcccgtta
cccggtgccacggcgctcaagcccggctcggcgacgcggccgctgttcggcgtagtgccg
gggctggtggacaatctcggcaacctgctggaaggcccggcggagggcaatctggtgatt
ctcgactcctggccagggcagatgcgcaccatttacggtgaccacgaccgtttcgtcgat
acctacttcaagaccttccgcggcatgtacttcaccggcgacggcgcgcgccgcgacgag
gacggttactactggatcaccgggcgcgtcgacgatgtgctcaacgtctccggacaccgc
atgggcaccgccgaaatcgagagcgccctggtggcgcatgccaaggtggccgaagccgcg
gccgttggcgtgccgcatccgctcaagggccaggccatctatgtttacgtgactctggtt
gctggtaccgagcccagcgacacgctgcgccaggagctgcagcagtgggtccggcacgag
atcggcccgatcgctgtgccggataccatccaatgggcgccggggctgccgaagacacgg
tccggcaagatcatgcgccgcctgctgcgcaagatcgccacggacgactacgacaccctg
ggcgatacctcgacgctggccgatccgggtgtggtggatcagctgattgaggcccatgaa
gcggtgaagtggtgctga

DBGET integrated database retrieval system