KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_1751Help
Entry
PSTAA_1751        CDS       T01976                                 

Gene name
nagZ
Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PSTAA_1751 (nagZ)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    PSTAA_1751 (nagZ)
Enzymes [BR:psr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PSTAA_1751 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1851962..1852960
Genome map
AA seq 332 aa AA seqDB search
MHGSLMLDIAGTWLTAEDRHLLRQPEVGGLILFARNIESPRQVEGLCRAIRAVRPDLLLA
VDQEGGRVQRLRQGFVRLPAMRELARCTDAPRLAEACGWVMASEVLAVGLDFSFAPVLDL
DHQRSAVVGARAFEGDPQVAVTLIDAFIRGMHAAGMAATGKHFPGHGWAEADSHVAIPVD
ERSLDELRRCDLIPFMALSGTLDAIMPAHVIYPQVDEQPAGFSRRWLQDILRNELGFKGV
IFSDDLSMAGAHVAGDAAQRIESALGAGCDMGLVCNDRGAAELALTALQRLKVTPSTALA
GMRGRAGCPADYKQNPRWLDAIGALKAADLID
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgcacggttcattgatgctggacatcgccggtacctggctgactgccgaggatcggcac
ctgctgcgccaacccgaagtgggtgggctcattctgttcgctcgcaatatcgagtctccg
cgacaagtggaggggctgtgccgtgcgattcgcgccgtgcgccccgatctgctgctggcg
gtggatcaggagggcggccgcgtgcagcggctgcgccagggtttcgtgcggcttccggcg
atgcgcgaactggcgcgttgcaccgacgctcccaggctggccgaagcctgtggctgggtc
atggccagcgaggtgcttgcggtgggcctggatttcagcttcgcgccggttctcgatctg
gatcatcagcgcagcgcggtggtaggcgcacgcgccttcgagggtgacccgcaggtcgcg
gtgacgctgatcgacgcctttattcgcggcatgcatgccgccggcatggccgccactggc
aagcacttccccgggcacggctgggccgaggccgattcgcatgtcgcgataccggtggat
gagcgcagcctcgacgagctgcgccgctgtgatctgattccctttatggcgctgagtggc
acgctcgatgcgatcatgccggcgcatgtcatctatcctcaggtcgacgagcagcccgcc
ggtttttcccgacgctggttgcaggacatcctgcgcaacgagttgggcttcaaaggcgtg
atcttcagcgacgatctctcgatggccggagcgcatgtcgcaggcgacgcggcgcagcgg
atcgaatccgctctgggcgctggttgcgacatggggctggtctgcaacgatcgtggggcc
gcagagctggcgctgactgcgctgcagcgcttgaaggtgacgccgtcgaccgcgctggcg
ggaatgcgtggccgggcgggctgcccggcggactacaagcagaaccctcgctggctggac
gccatcggcgcgctgaaggctgccgatctgattgactga

DBGET integrated database retrieval system