KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_1751Help
Entry
PSTAA_1751        CDS       T01976                                 

Gene name
nagZ
Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:psr00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:psr00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1851962..1852960
Genome map
AA seq 332 aa AA seqDB search
MHGSLMLDIAGTWLTAEDRHLLRQPEVGGLILFARNIESPRQVEGLCRAIRAVRPDLLLA
VDQEGGRVQRLRQGFVRLPAMRELARCTDAPRLAEACGWVMASEVLAVGLDFSFAPVLDL
DHQRSAVVGARAFEGDPQVAVTLIDAFIRGMHAAGMAATGKHFPGHGWAEADSHVAIPVD
ERSLDELRRCDLIPFMALSGTLDAIMPAHVIYPQVDEQPAGFSRRWLQDILRNELGFKGV
IFSDDLSMAGAHVAGDAAQRIESALGAGCDMGLVCNDRGAAELALTALQRLKVTPSTALA
GMRGRAGCPADYKQNPRWLDAIGALKAADLID
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgcacggttcattgatgctggacatcgccggtacctggctgactgccgaggatcggcac
ctgctgcgccaacccgaagtgggtgggctcattctgttcgctcgcaatatcgagtctccg
cgacaagtggaggggctgtgccgtgcgattcgcgccgtgcgccccgatctgctgctggcg
gtggatcaggagggcggccgcgtgcagcggctgcgccagggtttcgtgcggcttccggcg
atgcgcgaactggcgcgttgcaccgacgctcccaggctggccgaagcctgtggctgggtc
atggccagcgaggtgcttgcggtgggcctggatttcagcttcgcgccggttctcgatctg
gatcatcagcgcagcgcggtggtaggcgcacgcgccttcgagggtgacccgcaggtcgcg
gtgacgctgatcgacgcctttattcgcggcatgcatgccgccggcatggccgccactggc
aagcacttccccgggcacggctgggccgaggccgattcgcatgtcgcgataccggtggat
gagcgcagcctcgacgagctgcgccgctgtgatctgattccctttatggcgctgagtggc
acgctcgatgcgatcatgccggcgcatgtcatctatcctcaggtcgacgagcagcccgcc
ggtttttcccgacgctggttgcaggacatcctgcgcaacgagttgggcttcaaaggcgtg
atcttcagcgacgatctctcgatggccggagcgcatgtcgcaggcgacgcggcgcagcgg
atcgaatccgctctgggcgctggttgcgacatggggctggtctgcaacgatcgtggggcc
gcagagctggcgctgactgcgctgcagcgcttgaaggtgacgccgtcgaccgcgctggcg
ggaatgcgtggccgggcgggctgcccggcggactacaagcagaaccctcgctggctggac
gccatcggcgcgctgaaggctgccgatctgattgactga

DBGET integrated database retrieval system