KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_1758Help
Entry
PSTAA_1758        CDS       T01976                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
psr00260  Glycine, serine and threonine metabolism
psr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
psr01100  Metabolic pathways
psr01110  Biosynthesis of secondary metabolites
psr01130  Biosynthesis of antibiotics
psr01230  Biosynthesis of amino acids
Module
psr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:psr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSTAA_1758
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PSTAA_1758
Enzymes [BR:psr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PSTAA_1758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEA83657
UniProt: F2N1X7
Position
complement(1858476..1859684)
Genome map
AA seq 402 aa AA seqDB search
MSSDPRFTAMPDANGYFGPYGGQLVPPHLKQAMDDINLAYEEIRQREDFQQELAALFADY
VGRPSPIFHARRLSEQLGGAQIHLKREDLNHTGAHKINHCLGEALLARFMGKTKVIAETG
AGQHGVALATACALVGIPCEIHMGQVDIEKEHPNVTKMKILGCKLVAVTRGAATLKEAVD
SAFEEYLKDPQNYLYAIGSVVGPHPFPKMVRDFQSIIGQEARGQFLARHGCLPDQVVACV
GGGSNAMGIFTAFLEDAAVELVGIEPAGESLDKPGRHSATLSKGKPGELHGMACYVLEDA
EGNPSAVHSIASGLDYPGVGPQHSYLKDIGRVNYQTATDQECLDAFMTLSRVEGIIPALE
SAHAVAWAIRTAPTLGKDSHILVNLSGRGDKDADYVAKLLGL
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccgatcctcgtttcactgccatgcccgacgccaacggctacttcggcccctac
ggtggccagctggtgccgccgcacctcaagcaggcgatggacgacatcaacctggcctac
gaagagatccgccagcgcgaggatttccagcaggaactggcggccctgttcgccgactac
gtgggccggccgagcccgatcttccatgcccggcgcctgtccgagcagctcggtggcgcg
cagattcacctgaagcgcgaggacctgaatcacaccggggcacacaagatcaatcactgt
ctgggcgaggcactgcttgcccggttcatgggcaagaccaaggtgatcgccgagaccggc
gccggccaacacggtgtcgccctggccaccgcctgcgcgctggtgggcatcccctgcgag
atccacatgggccaggtggacatcgagaaggaacatcccaacgtcaccaagatgaagatc
ctcggctgcaagctggtggcggtcacccgcggcgcggcgacgctcaaggaagcggtggac
agcgccttcgaggaatacctgaaggatccgcagaactacctctacgccatcggctcggtg
gtaggcccgcatccgttcccgaagatggtccgcgatttccagtcgatcatcggtcaagag
gcgcgcggccagtttctcgccaggcatggttgcctgccggaccaggtggtcgcctgcgtc
ggcggcggttccaatgccatgggtatcttcacagcctttctggaagacgccgcggtcgag
ctggtgggcatcgagccggcgggcgaaagcctggacaagcccggccgccattcggccacc
ctgtccaagggcaaacccggtgaactacacggcatggcctgctacgtgctggaagatgcc
gagggcaacccgtccgcagtgcactccatcgcctccggcctggactatcccggcgtcggc
cctcagcacagctacctcaaggacatcggccgggtgaactaccagaccgcgaccgaccag
gagtgtctggatgccttcatgaccctgtcgcgcgtcgaaggcatcatccccgccctggaa
agtgcccatgcggtggcctgggcgattcgtaccgcgccgacgctgggcaaggacagccac
attctggtcaacctctccggccgcggcgacaaggatgccgactacgtcgccaagctgctc
ggcctgtaa

DBGET integrated database retrieval system