KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_1758Help
Entry
PSTAA_1758        CDS       T01976                                 

Definition
tryptophan synthase subunit beta
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:psr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PSTAA_1758
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSTAA_1758
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PSTAA_1758
Enzymes [BR:psr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PSTAA_1758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1858476..1859684)
Genome map
AA seq 402 aa AA seqDB search
MSSDPRFTAMPDANGYFGPYGGQLVPPHLKQAMDDINLAYEEIRQREDFQQELAALFADY
VGRPSPIFHARRLSEQLGGAQIHLKREDLNHTGAHKINHCLGEALLARFMGKTKVIAETG
AGQHGVALATACALVGIPCEIHMGQVDIEKEHPNVTKMKILGCKLVAVTRGAATLKEAVD
SAFEEYLKDPQNYLYAIGSVVGPHPFPKMVRDFQSIIGQEARGQFLARHGCLPDQVVACV
GGGSNAMGIFTAFLEDAAVELVGIEPAGESLDKPGRHSATLSKGKPGELHGMACYVLEDA
EGNPSAVHSIASGLDYPGVGPQHSYLKDIGRVNYQTATDQECLDAFMTLSRVEGIIPALE
SAHAVAWAIRTAPTLGKDSHILVNLSGRGDKDADYVAKLLGL
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccgatcctcgtttcactgccatgcccgacgccaacggctacttcggcccctac
ggtggccagctggtgccgccgcacctcaagcaggcgatggacgacatcaacctggcctac
gaagagatccgccagcgcgaggatttccagcaggaactggcggccctgttcgccgactac
gtgggccggccgagcccgatcttccatgcccggcgcctgtccgagcagctcggtggcgcg
cagattcacctgaagcgcgaggacctgaatcacaccggggcacacaagatcaatcactgt
ctgggcgaggcactgcttgcccggttcatgggcaagaccaaggtgatcgccgagaccggc
gccggccaacacggtgtcgccctggccaccgcctgcgcgctggtgggcatcccctgcgag
atccacatgggccaggtggacatcgagaaggaacatcccaacgtcaccaagatgaagatc
ctcggctgcaagctggtggcggtcacccgcggcgcggcgacgctcaaggaagcggtggac
agcgccttcgaggaatacctgaaggatccgcagaactacctctacgccatcggctcggtg
gtaggcccgcatccgttcccgaagatggtccgcgatttccagtcgatcatcggtcaagag
gcgcgcggccagtttctcgccaggcatggttgcctgccggaccaggtggtcgcctgcgtc
ggcggcggttccaatgccatgggtatcttcacagcctttctggaagacgccgcggtcgag
ctggtgggcatcgagccggcgggcgaaagcctggacaagcccggccgccattcggccacc
ctgtccaagggcaaacccggtgaactacacggcatggcctgctacgtgctggaagatgcc
gagggcaacccgtccgcagtgcactccatcgcctccggcctggactatcccggcgtcggc
cctcagcacagctacctcaaggacatcggccgggtgaactaccagaccgcgaccgaccag
gagtgtctggatgccttcatgaccctgtcgcgcgtcgaaggcatcatccccgccctggaa
agtgcccatgcggtggcctgggcgattcgtaccgcgccgacgctgggcaaggacagccac
attctggtcaacctctccggccgcggcgacaaggatgccgactacgtcgccaagctgctc
ggcctgtaa

DBGET integrated database retrieval system