KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_1849Help
Entry
PSTAA_1849        CDS       T01976                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:psr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PSTAA_1849 (recR)
DNA repair and recombination proteins [BR:psr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      PSTAA_1849 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1955647..1956246
Genome map
AA seq 199 aa AA seqDB search
MSFSPLIRQLIDALRILPGVGQKTAQRMALQLLERDRSGGLRLAQALTRAMEGVGYCRQC
RTLTEDELCPQCADPRRDDSLLCVVQSPVDVFAVEQTGFRGRYFVLKGHLSPLDGLGPEA
IGIPELLGRVAGGAFSEVILATNPTVEGEATAHYIAQMLIPKGLTISRIAHGVPLGGELD
LVDGGTLAHALAGRKPISL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcagcccgctgattcggcaactcatcgatgccctgcgcattcttcctggcgta
ggacagaagaccgcgcaacgcatggcgcttcagctgctcgagcgtgaccgcagcggtggt
ctgcgcctggcgcaggcgttgacccgggcgatggaaggtgtcggttactgcaggcagtgc
cgtacgctgaccgaagacgaactctgcccgcagtgcgctgatccgcggcgggatgattcc
ctgctatgcgtggtgcagagcccggtcgacgtgtttgcggtcgagcagaccggctttcgt
gggcgttacttcgtgctcaaggggcatctgtctccgctcgatggcctggggccagaggcc
atcggcattcccgagctgctggggcgggtggcgggtggcgcattcagcgaagtcatcctg
gcaacaaaccccactgtcgaaggggaagccaccgcgcactacatcgcacagatgctcatt
cccaaaggcctgaccatcagccgaattgcccatggtgttccactgggcggcgagctggac
ctggtcgatggcggcacactggctcacgccctcgcagggcgcaagccgatcagcctataa

DBGET integrated database retrieval system