KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_1898Help
Entry
PSTAA_1898        CDS       T01976                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase (D subunit)
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
psr00020  Citrate cycle (TCA cycle)
psr00190  Oxidative phosphorylation
psr00650  Butanoate metabolism
psr01100  Metabolic pathways
psr01110  Biosynthesis of secondary metabolites
psr01120  Microbial metabolism in diverse environments
psr01130  Biosynthesis of antibiotics
psr01200  Carbon metabolism
Module
psr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
psr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:psr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSTAA_1898 (sdhD)
   00650 Butanoate metabolism
    PSTAA_1898 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    PSTAA_1898 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: AEA83793
UniProt: F2MXE7
Position
2006636..2007004
Genome map
AA seq 122 aa AA seqDB search
MVTNVTNFSRSGLYDWMAQRVSAVVLAAYFLFLLGYLIANPGLEYTQWHALFSANWMRIF
SLLALVALSVHAWVGMWTISTDYLTNMAIGKWATGVRFLFQAVCGIAMFTFFVWGVQILW
GI
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaatgtcaccaacttttcgcgctcgggtctgtacgactggatggcgcagcgc
gtttctgcagtggttcttgcggcttattttctgttcctgcttgggtacctgattgcgaac
ccaggactggagtacacccagtggcacgcgctgttctcggccaactggatgcgcatcttc
agtctgctggctctggtcgccctgagtgtgcacgcgtgggtaggcatgtggacgatctcc
accgactacctgaccaatatggcgatcggtaagtgggctaccggcgttcgtttcctgttc
caggcggtgtgtggcattgccatgttcaccttcttcgtctggggcgtgcagattctttgg
ggtatctga

DBGET integrated database retrieval system