KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_1902Help
Entry
PSTAA_1902        CDS       T01976                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
psr00020  Citrate cycle (TCA cycle)
psr00310  Lysine degradation
psr01100  Metabolic pathways
psr01110  Biosynthesis of secondary metabolites
psr01120  Microbial metabolism in diverse environments
psr01130  Biosynthesis of antibiotics
psr01200  Carbon metabolism
Module
psr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:psr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSTAA_1902 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    PSTAA_1902 (sucB)
Enzymes [BR:psr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PSTAA_1902 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N
Motif
Other DBs
NCBI-ProteinID: AEA83797
UniProt: F2MXF1
Position
2012691..2013917
Genome map
AA seq 408 aa AA seqDB search
MAIEIKAPTFPESVADGTVATWHKQPGDAVKRDELIVDIETDKVVMEVLAEADGVLTEIV
KNEGDTVLSGELLGKLEAGAAAAAAPAQAAAPAPAAAAPAAAASAGGEEPILAPAARKLA
EENGIDPNSIRGTGKDGRVTKEDVVAAVEAKKSAPAAAAKPAAPAAAAPIFAEGDRVEKR
VPMTRLRAKVAERLVEAQSSMAMLTTFNEVNMKPIMELRAKYKDLFEKTHNGVRLGFMSF
FVKAAVEALKRQPGVNASIDGNDIVYHGYQDIGVAVSSDRGLVVPVLRNAEHMSLAEIEG
GINEFGKKAKAGKLTIEEMTGGTFTISNGGVFGSLLSTPIVNPPQTAILGMHKIQERPMA
VNGQVVILPMMYLALSYDHRLIDGKEAVTFLVTMKDLLEDPARLLLDI
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgagatcaaagcccctacattcccggaatcggtcgccgacggcaccgttgcc
acctggcacaagcagccgggcgacgcggttaagcgtgatgaactgatcgtcgacatcgaa
accgacaaggtggtcatggaagtactggccgaagcagacggcgtgctgaccgagatcgtc
aagaacgaaggcgacaccgtgctgagcggcgagctgctcggcaagctggaagcaggcgct
gctgccgccgctgcacccgctcaagctgccgccccggccccggccgctgctgctccggca
gccgctgccagcgcgggtggcgaagagccgatcctggccccggcggcccgcaagctggcc
gaagagaacggtattgatccgaacagcatccgcggtaccggcaaggacggtcgcgtgacc
aaggaagacgtcgtcgccgccgtcgaagccaagaagtccgctccggctgccgctgccaag
ccggccgctcctgccgctgcggctccgatcttcgccgagggtgatcgcgtcgagaagcgc
gtgccgatgacccgcctgcgtgccaaggtcgccgagcgtctggtcgaagcccagtcctcc
atggctatgctgactacgttcaacgaagtcaacatgaagccgatcatggaactgcgcgcc
aagtacaaggacctcttcgagaagacccataacggcgtgcgcctgggcttcatgtccttc
ttcgtcaaggctgcggtggaagcgctcaagcgccagccgggcgtcaatgcctccatcgac
ggcaacgacatcgtctaccacggttatcaggacatcggcgtcgccgtttccagcgaccgc
ggtctggtggtgccggtcctgcgtaacgccgagcacatgagcctggcggagatcgaaggc
ggcatcaacgagttcggcaagaaggccaaggccggcaagctgaccatcgaggaaatgact
ggcggtaccttcaccatctccaacggtggtgtgttcggttccctgctgtcgaccccgatc
gtcaacccgccgcagactgccatcctcggcatgcacaagattcaggaacgtccgatggcc
gtcaacggtcaggtggtcatcctgccgatgatgtacctggcgctgtcctatgaccatcgc
ttgatcgacggcaaggaagctgtgaccttcctggttaccatgaaggacctgctggaagac
ccggcccgtctgctgctggatatctga

DBGET integrated database retrieval system