KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_1904Help
Entry
PSTAA_1904        CDS       T01976                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
psr00020  Citrate cycle (TCA cycle)
psr00640  Propanoate metabolism
psr00660  C5-Branched dibasic acid metabolism
psr01100  Metabolic pathways
psr01110  Biosynthesis of secondary metabolites
psr01120  Microbial metabolism in diverse environments
psr01130  Biosynthesis of antibiotics
psr01200  Carbon metabolism
Module
psr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:psr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSTAA_1904 (sucC)
   00640 Propanoate metabolism
    PSTAA_1904 (sucC)
   00660 C5-Branched dibasic acid metabolism
    PSTAA_1904 (sucC)
Enzymes [BR:psr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PSTAA_1904 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp OKR_DC_1_N
Motif
Other DBs
NCBI-ProteinID: AEA83799
UniProt: F2MXF3
Position
2015644..2016810
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQGKQLFAEYGLPVSKGYAVDSPKEAAEACDKIGGTQWVVKAQVHAGGRGKAGGV
KLVRSKDEARAFAQQWLDKRLVTYQTDANGQPVSKILVEACTDIDKELYLGAVVDRASRR
IVFMASTEGGVDIEKVAHDTPEKILKATIDPLVGAQPFQARELAFQLGLKGDQVKQFVHI
FVGLAQLFQDYDLALLEVNPLVIKTDGNLHCLDAKINIDSNAIYRQPKLRDMADPSQDDP
REAHAAKWELNYVALDGNIGCMVNGAGLAMGTMDIVNLHGGAPANFLDVGGGATEERVTE
AFKIILSDSNVAAVLVNIFGGIVRCDMIAEGIIGAVREVGVKVPVVVRLEGNNADLGAKM
LSESGLNIIGANSLTDAAIQVVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttcacgagtaccaaggtaaacaactgttcgctgaatacggtctgcccgtgtcc
aaaggctatgcggtagatagcccgaaggaagcagcggaagcctgcgacaagatcggcggc
acacaatgggtggtcaaggcccaggtgcatgccggtggacgtggcaaggcgggtggcgta
aagctggttcgcagcaaggatgaggcccgggcgttcgcccagcagtggctcgacaagcgt
ctggtgacctaccagaccgatgccaatggtcagccggtcagcaagattctggtcgaggcg
tgcaccgatatcgacaaggagctctacctgggcgccgtggtcgatcgcgccagtcgccgg
atcgtcttcatggcgtcgaccgaaggtggtgtggacatcgaaaaagtcgctcacgacacg
cccgagaaaatcctcaaggccaccatcgatccgctggtaggcgcgcagcccttccaggcg
cgcgaactggcgttccagttgggcctcaagggtgaccaggtcaagcagttcgtacacatc
ttcgtcggcctcgcccagctgttccaggactatgatctggccctgctggaagtgaacccg
ctggtgatcaagaccgacggcaatctgcactgcctggacgccaagatcaacatcgatagc
aacgccatctatcgccagccgaagctgcgcgacatggccgacccgtcacaggacgatccg
cgcgaggcgcatgctgccaagtgggagctcaattacgtggcgctcgacggcaacatcggt
tgcatggtcaacggtgccggtctggccatgggcaccatggacatcgtcaacctgcacggc
ggcgcgccggcgaacttcctcgacgtgggcggtggcgccaccgaggagcgcgtgaccgaa
gcgttcaagatcattctctccgacagcaatgtcgctgcggttctggtgaacatcttcggt
ggcatcgtgcgttgcgacatgatcgccgagggcatcatcggtgccgtgcgtgaagtgggg
gtcaaggtgccggtggtggtgcggctggaaggcaacaacgccgacctgggcgccaagatg
ctgagtgagagcggtctgaacatcatcggtgcgaacagcctgaccgatgcggccattcag
gttgtcaaagccgcggagggcaagtaa

DBGET integrated database retrieval system