KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_2003Help
Entry
PSTAA_2003        CDS       T01976                                 

Gene name
folE-1
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:psr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PSTAA_2003 (folE-1)
Enzymes [BR:psr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PSTAA_2003 (folE-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2136370..2136927)
Genome map
AA seq 185 aa AA seqDB search
MNDLPGHYRDILTGLGEDPEREGLRDTPTRAAKTMQYLCGGYQRSLEEIVNGALFASDND
EMVIVKDIELYSLCEHHLLPFIGKAHVAYIPTGRVLGLSKVARIVDMYARRLQIQENLTR
QIAEAIQEVTGAAGVAVVIEAKHMCMMMRGVEKQNSVMNTSVMLGAFRNSCTTRMEFLQL
IGRGQ
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatctgcccggtcattatcgcgacatactcaccggcctcggcgaagaccccgag
cgcgaggggctgcgggatacgccaacgcgcgccgccaagaccatgcagtacctgtgcggc
ggttaccagcgcagcctggaggaaatcgtcaacggcgccctgttcgcctccgacaacgat
gaaatggtgatcgtcaaggacatcgagctgtactcgctgtgcgaacaccacctgctgccc
ttcatcggcaaggcgcatgtcgcctacatccccaccgggcgtgtgctgggtctgtccaag
gtggcgcgcatcgtcgacatgtatgcgcggcgcctgcagatccaggaaaacctcacccgt
cagatcgccgaagcgatccaggaagtgaccggcgccgccggagtcgcggtggtcatcgag
gccaagcacatgtgcatgatgatgcgcggcgtggagaagcagaattcggtgatgaacacg
tcggtgatgctcggcgccttccgcaactcctgcaccacgcgcatggagtttctccagctg
atcggcaggggccagtga

DBGET integrated database retrieval system