KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_2339Help
Entry
PSTAA_2339        CDS       T01976                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
psr00630  Glyoxylate and dicarboxylate metabolism
psr01100  Metabolic pathways
psr01110  Biosynthesis of secondary metabolites
psr01120  Microbial metabolism in diverse environments
psr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psr00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PSTAA_2339
Enzymes [BR:psr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     PSTAA_2339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase Lipase_GDSL_2
Motif
Other DBs
NCBI-ProteinID: AEA84227
UniProt: F2N5T3
Position
2513852..2515447
Genome map
AA seq 531 aa AA seqDB search
MSAYQDDIKAVAALKEQYGSSWAAINPESVARMRAQNRFKTGLEIAQYTADIMRKDMAEY
DADSSVYTQSLGCWHGFIGQQKLISIKKHLKTTNKRYLYLSGWMVAALRSEFGPLPDQSM
HEKTAVSDLIEELYTFLRQADSRELDLLFTALDAAREAGDNAKAAEIQNQIDNYETHIVP
IIADIDAGFGNPEATYLLAKRMIEAGACCIQIENQVSDEKQCGHQDGKVTVPHADFLAKI
AAVRYAFLELGIDNGVIVARTDSLGAGLTKQIAVTKEPGDLGDLYNSFLDCEEISEAELG
NGDVVIKREGKLLRPKRLPSNLFQFRAGTGEDRCVLDCITSLQNGADLLWIETEKPHVGQ
IKAMVDRIREVIPNAKLVYNNSPSFNWTLNFRQQVFDAFVAEGKDVSAYDRAKLMSVEYD
ETELAQVADEKIRTFQRDGSAHAGIFHHLITLPTYHTAALSTDNLAKGYFADQGMLAYVK
GVQREELRQGIACVKHQNMAGSDIGDNHKEYFAGEAALKASGKDNTMNQFH
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcatatcaagacgacatcaaggcagttgccgccctgaaagagcaatacggcagc
agctgggccgccatcaaccctgagtccgtcgctcgcatgcgcgcccagaaccgcttcaag
accggtctggaaatcgctcagtacaccgccgacatcatgcgcaaggacatggccgagtac
gacgccgactcgtccgtctacacgcagtccctcggctgctggcacggcttcattggtcag
cagaagctgatctccatcaagaagcacctgaagaccaccaacaagcgctacctctacctg
tccggctggatggttgctgctctgcgttccgagttcggcccgctgccggaccagtccatg
cacgagaagaccgccgtttccgacctgatcgaggagctgtacaccttcctgcgtcaggct
gacagccgcgaactggacctgctgttcaccgccctggacgctgctcgtgaagctggcgac
aacgccaaggctgccgagatccagaaccagatcgacaactacgaaacccacatcgtaccg
atcatcgctgacatcgacgctggcttcggtaacccggaagccacctacctgctggccaag
cgcatgatcgaagcaggcgcttgctgcatccagatcgagaaccaggtttccgacgagaag
cagtgcggccaccaggacggtaaagtaaccgttccgcacgccgacttcctcgccaagatc
gctgccgttcgttacgccttcctcgagctgggcatcgacaacggcgtgatcgttgctcgt
accgactccctgggtgccggcctgaccaagcagattgccgtgaccaaagagccgggcgac
ctgggcgacctgtacaactccttcctggattgcgaagaaatctccgaagccgagctgggc
aatggcgacgtcgtaatcaagcgcgaaggcaagctgctgcgtccgaagcgtctgccgtcc
aacctgttccagttccgcgctggcaccggcgaagaccgctgcgttctggactgcatcacg
tcgctgcagaacggcgccgacctgctgtggatcgaaaccgagaagccgcacgttggccag
atcaaggccatggttgaccgcatccgcgaagtcatcccgaacgccaagctggtctacaac
aacagcccgtccttcaactggacgctgaacttccgtcagcaggtgttcgacgctttcgtt
gccgaaggcaaggacgtgtccgcctacgaccgcgccaagctgatgagcgtcgagtacgac
gaaaccgagctggcccaggttgcagacgagaagatccgtactttccagcgcgacggttcg
gctcacgccggcatcttccaccacctgatcaccctgccgacctaccacactgctgctctg
tcgaccgacaacctggccaagggctactttgccgaccagggcatgctggcctacgtcaag
ggcgttcagcgcgaggaactgcgtcagggtatcgcctgcgtcaagcaccagaacatggct
ggttctgacatcggcgacaaccacaaggagtacttcgctggcgaagctgctctgaaggca
agcggcaaagacaacaccatgaaccagttccactaa

DBGET integrated database retrieval system