KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_2339Help
Entry
PSTAA_2339        CDS       T01976                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSTAA_2339
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PSTAA_2339
Enzymes [BR:psr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     PSTAA_2339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2513852..2515447
Genome map
AA seq 531 aa AA seqDB search
MSAYQDDIKAVAALKEQYGSSWAAINPESVARMRAQNRFKTGLEIAQYTADIMRKDMAEY
DADSSVYTQSLGCWHGFIGQQKLISIKKHLKTTNKRYLYLSGWMVAALRSEFGPLPDQSM
HEKTAVSDLIEELYTFLRQADSRELDLLFTALDAAREAGDNAKAAEIQNQIDNYETHIVP
IIADIDAGFGNPEATYLLAKRMIEAGACCIQIENQVSDEKQCGHQDGKVTVPHADFLAKI
AAVRYAFLELGIDNGVIVARTDSLGAGLTKQIAVTKEPGDLGDLYNSFLDCEEISEAELG
NGDVVIKREGKLLRPKRLPSNLFQFRAGTGEDRCVLDCITSLQNGADLLWIETEKPHVGQ
IKAMVDRIREVIPNAKLVYNNSPSFNWTLNFRQQVFDAFVAEGKDVSAYDRAKLMSVEYD
ETELAQVADEKIRTFQRDGSAHAGIFHHLITLPTYHTAALSTDNLAKGYFADQGMLAYVK
GVQREELRQGIACVKHQNMAGSDIGDNHKEYFAGEAALKASGKDNTMNQFH
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcatatcaagacgacatcaaggcagttgccgccctgaaagagcaatacggcagc
agctgggccgccatcaaccctgagtccgtcgctcgcatgcgcgcccagaaccgcttcaag
accggtctggaaatcgctcagtacaccgccgacatcatgcgcaaggacatggccgagtac
gacgccgactcgtccgtctacacgcagtccctcggctgctggcacggcttcattggtcag
cagaagctgatctccatcaagaagcacctgaagaccaccaacaagcgctacctctacctg
tccggctggatggttgctgctctgcgttccgagttcggcccgctgccggaccagtccatg
cacgagaagaccgccgtttccgacctgatcgaggagctgtacaccttcctgcgtcaggct
gacagccgcgaactggacctgctgttcaccgccctggacgctgctcgtgaagctggcgac
aacgccaaggctgccgagatccagaaccagatcgacaactacgaaacccacatcgtaccg
atcatcgctgacatcgacgctggcttcggtaacccggaagccacctacctgctggccaag
cgcatgatcgaagcaggcgcttgctgcatccagatcgagaaccaggtttccgacgagaag
cagtgcggccaccaggacggtaaagtaaccgttccgcacgccgacttcctcgccaagatc
gctgccgttcgttacgccttcctcgagctgggcatcgacaacggcgtgatcgttgctcgt
accgactccctgggtgccggcctgaccaagcagattgccgtgaccaaagagccgggcgac
ctgggcgacctgtacaactccttcctggattgcgaagaaatctccgaagccgagctgggc
aatggcgacgtcgtaatcaagcgcgaaggcaagctgctgcgtccgaagcgtctgccgtcc
aacctgttccagttccgcgctggcaccggcgaagaccgctgcgttctggactgcatcacg
tcgctgcagaacggcgccgacctgctgtggatcgaaaccgagaagccgcacgttggccag
atcaaggccatggttgaccgcatccgcgaagtcatcccgaacgccaagctggtctacaac
aacagcccgtccttcaactggacgctgaacttccgtcagcaggtgttcgacgctttcgtt
gccgaaggcaaggacgtgtccgcctacgaccgcgccaagctgatgagcgtcgagtacgac
gaaaccgagctggcccaggttgcagacgagaagatccgtactttccagcgcgacggttcg
gctcacgccggcatcttccaccacctgatcaccctgccgacctaccacactgctgctctg
tcgaccgacaacctggccaagggctactttgccgaccagggcatgctggcctacgtcaag
ggcgttcagcgcgaggaactgcgtcagggtatcgcctgcgtcaagcaccagaacatggct
ggttctgacatcggcgacaaccacaaggagtacttcgctggcgaagctgctctgaaggca
agcggcaaagacaacaccatgaaccagttccactaa

DBGET integrated database retrieval system