KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_2513Help
Entry
PSTAA_2513        CDS       T01976                                 

Definition
carbohydrate kinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:psr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSTAA_2513
   01230 Biosynthesis of amino acids
    PSTAA_2513
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSTAA_2513
   00030 Pentose phosphate pathway
    PSTAA_2513
   00051 Fructose and mannose metabolism
    PSTAA_2513
   00052 Galactose metabolism
    PSTAA_2513
  Energy metabolism
   00680 Methane metabolism
    PSTAA_2513
Enzymes [BR:psr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PSTAA_2513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2699777..2700712)
Genome map
AA seq 311 aa AA seqDB search
MPLIATLTLNPAMDLSVSTARVTDTQKLRCSAPRHDPGGGGINVARVVKTLGGKAVAVYP
AGGAFGDLLRRSLDELGLVHRPVPIAGDTRESFTVDELQSGLQYRFVLPGPVLSAQELER
CLQTLAALRPAPAYVVLSGSFPPGTDLAFFDDLRALTLRLGARLVVDLSGEPLCHAARHG
GVYLMKPSLEELSTLMGGALTSEAEQQEALRSLIARGCAEIVVLSLGAEGALYAYGERLE
RLRSPQVPVVSAVGAGDSMLGAIVQALADGRSVDAAVRQGIAAGAATVMRPGTELCHRDD
VQRLLEALERA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgattgcgaccctgaccctcaacccggcgatggacctttcggtcagcaccgcc
cgggtcaccgatacccagaagctgcgctgttctgcgcctcgccatgaccctggcggtggc
ggcatcaacgtcgcgcgggtggtgaagaccctcggtggcaaggcggtcgccgtctacccg
gccgggggggcgttcggcgatctgctgcggcgttcgctcgacgaactcggactggtgcat
cgccccgtgcccatcgccggcgatacgcgggagagtttcaccgtcgatgagctgcaatcg
ggcctgcagtaccgcttcgtgctacctggtccggtgctgtcggcgcaggagctggagcgc
tgcctgcagacactggcggcgctgcgtccggcgccagcgtacgtcgtgctgagcggcagc
tttccgcccggcacggacctggccttcttcgatgacctgcgcgccctgaccctgcggctc
ggtgcccggctggtggtcgacctctccggtgagccgctatgccatgcggcccggcatggc
ggtgtgtacctgatgaagcccagtctcgaggagctttccaccctgatgggcggcgccctg
accagcgaggccgagcagcaagaggccctgcgcagcctgatcgcccggggctgcgccgag
atcgtcgtactgtctctgggggccgagggtgcgctgtatgcctatggcgaacggctggag
cgcctgcgctcgccgcaggttccggtggtcagcgcagtgggggcgggcgacagcatgttg
ggtgccatcgtgcaggcactggcggatgggcgttcggtagacgcggcggtgcgccagggc
atcgcggccggtgccgcgacggtgatgcggcctggcaccgagctgtgccatcgcgacgat
gtgcagcgcttgctcgaggcgctggagcgcgcctag

DBGET integrated database retrieval system