KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_2601Help
Entry
PSTAA_2601        CDS       T01976                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PSTAA_2601
Enzymes [BR:psr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     PSTAA_2601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2794053..2795108
Genome map
AA seq 351 aa AA seqDB search
MRSTRLAVALAAALSAVGVCAADWPVNDEGGLALHGVNISGAGFAPHITPGKNGTHYFYP
EKKHFKYYADQGIRLIRFPFIWERVQHSLDSGLNFDQIRLLKKTLDLAAQNGQKVILDMH
NYGRYHGELIGSSKVPYEAYASVWRKLAERFKGHPGLLGYDIMNEPHSTVGLWPGAAQAA
VDAIREVDDQTLIFIEGERWSSAYHWPLVNANFLINDPADRLIYEAHLYFDDDFSGKYMA
QTSRNIDPMIGVERARPFIEWLQKHGQKGFLGEYGIPDDLPEAAQAMDNLLAYLNDNCVP
SAYWAGGPGWGTYKLAIEPRNGKDRPQMELMRKHLANDCTAIGPTPAQIAD
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgcgctcgacccgactggcagtggccctggccgccgcgctgtcggctgtcggcgtgtgc
gccgccgactggcctgtcaatgacgaaggaggcctggccctgcacggggtcaacatctcc
ggtgccggcttcgccccgcacatcacgccgggcaagaacggcactcactacttctacccc
gagaagaaacacttcaagtactacgccgatcagggcatccgcctgatccgctttccgttc
atctgggagcgcgtgcagcactcgctcgattccggattgaacttcgaccagatccggttg
ttgaagaagaccctggatctggccgcacagaacggccagaaggtcattctggacatgcac
aactatggtcgttaccacggcgaactcatcggctcgagcaaggtgccctacgaagcctat
gcctcggtgtggcgcaagctggccgagcgcttcaaaggtcacccgggcctgctcggctac
gacatcatgaacgagccgcacagcaccgtgggcctctggcctggcgcagcccaggcggcg
gtcgatgcgatccgcgaagtcgacgaccagacgctgatattcatcgagggcgagcgctgg
tcgagcgcctatcactggccgctggtgaacgccaatttcctgatcaacgacccggccgac
cgcctcatctacgaggcgcacctgtacttcgacgacgacttctccggcaagtacatggcc
cagaccagccgcaacatcgatccgatgatcggcgtcgaacgcgcgcggccattcatcgag
tggctgcagaagcatggccagaaaggcttcctcggcgagtacggcatccccgacgacctg
cccgaagcggcgcaagcgatggacaacctgctcgcctatctgaacgacaactgcgtgccc
agcgcgtactgggccggcggccccggctggggcacctacaagcttgcgatcgagccgcgc
aacggcaaagaccgtccgcagatggagctcatgcgcaagcacctggccaacgactgcacg
gccatcggccctacacctgcgcaaattgctgattga

DBGET integrated database retrieval system