KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_2932Help
Entry
PSTAA_2932        CDS       T01976                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:psr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3120697..3121302)
Genome map
AA seq 201 aa AA seqDB search
MIGRLRGTLAEKQPPHMILDVNGIGYEVEVPMTTLYRLPAVGEPVTLHTHLVVREDAQLL
YGFAEKRERELFRELIRLNGVGPKLALALMSGLEVDELVRCVQAQDTSVLVRIPGVGKKT
AERLLVELKDRFKAWESMPAIATLVVEPGSKTAVTSAENDAVSALISLGFKPQEASRAVS
AIQEENLSSEEMIRRALKGMV
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
ttgatcggacgtttgcgcggcacgctggcggaaaagcaaccgcctcacatgattctcgac
gtcaacggcatcggctatgaagtcgaggtgccgatgactacgctttatcgcctgccagcg
gtcggcgagccggtgactctgcacacccatctggtggtgcgtgaagacgcgcagctgctt
tatgggttcgccgagaaacgcgagcgtgagctatttcgcgagctgatccggctgaacggc
gtgggacccaagttggctttggcgctcatgtcggggctggaggtcgatgagttggtgcgg
tgcgttcaggcgcaggatacctcggtgctggtgcgcatacctggtgtcggcaagaagacc
gccgaacggctgctggttgagctgaaggaccgcttcaaggcgtgggaaagcatgccggcc
atcgcgaccctggtagttgaacctggcagcaaaacggcagtcacaagcgccgagaatgat
gcagtcagcgctttgatttccctgggcttcaagccccaggaggccagccgggcagtgtcc
gccatacaggaagagaatttgagcagtgaagagatgattcgccgcgccctcaagggcatg
gtgtaa

DBGET integrated database retrieval system